DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4789 and Rab39

DIOPT Version :9

Sequence 1:NP_573166.1 Gene:CG4789 / 32668 FlyBaseID:FBgn0030792 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001245568.1 Gene:Rab39 / 31684 FlyBaseID:FBgn0029959 Length:218 Species:Drosophila melanogaster


Alignment Length:230 Identity:43/230 - (18%)
Similarity:83/230 - (36%) Gaps:67/230 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RIVVVGDSGVGKTSLTHLITHNEALIRPGWTVGCNIQVKMHPFREGTARECPYFVELFDVGGSLN 72
            |::::|||.|||:||....|..:.......|||.:...::...::||..:    ::|:|..|...
  Fly    11 RLILIGDSTVGKSSLLKFFTDGKFAELSDPTVGVDFFARLIEMKDGTQIK----LQLWDTAGQER 71

  Fly    73 HKNTRSVFYAGIDGIILVHDLTNAKSQRQLIDWLYEIVNKEGKDTNKSNGASMPPSPPSPLSSFS 137
            .::....:|....|::||:|::|..|...:..|:.|              |.....|..|:    
  Fly    72 FRSITKSYYRNSVGVLLVYDISNHASFEHIPLWMME--------------AQRHIEPHRPV---- 118

  Fly   138 TDNLGTDGHILFDMEEFLGATQTPILVMGTKLDLLDEKRHPKMGVKKPGGIADKCG--------- 193
                                    ..::|.||||::...|.::..::....|.:.|         
  Fly   119 ------------------------FALVGCKLDLINAGGHREVTTEEAQKFAKQHGLHFVETSAR 159

  Fly   194 ------------AEEIWLNCRNSRSLAAGTTDAVK 216
                        .:|::...|:....|....|.:|
  Fly   160 SGANVEEAFRMVTQEVYARIRSGEYKAEDGWDGIK 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4789NP_573166.1 P-loop_NTPase 7..228 CDD:304359 43/230 (19%)
Rab39NP_001245568.1 Rab39 8..218 CDD:133311 43/230 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454506
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.