DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4789 and Rab27

DIOPT Version :9

Sequence 1:NP_573166.1 Gene:CG4789 / 32668 FlyBaseID:FBgn0030792 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_726743.1 Gene:Rab27 / 31103 FlyBaseID:FBgn0025382 Length:236 Species:Drosophila melanogaster


Alignment Length:232 Identity:52/232 - (22%)
Similarity:86/232 - (37%) Gaps:73/232 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RIVVVGDSGVGKTSLTHLIT----HNEALIRPGWTVGCNIQVKMHPFRE------GTARECPYFV 62
            :.:|:||||||||.|.:..|    |.:.:.    |||.:       |||      ...|.....:
  Fly    19 QFLVLGDSGVGKTCLLYQYTDGRFHTQFIS----TVGID-------FREKRLLYNSRGRRHRIHL 72

  Fly    63 ELFDVGGSLNHKNTRSVFYAGIDGIILVHDLTNAKSQRQLIDWLYEIVNKEGKDTNKSNGASMPP 127
            :::|..|....::..:.||....|.:|:.|||:.||..:..:||.::         :::..|..|
  Fly    73 QIWDTAGQERFRSLTTAFYRDAMGFLLIFDLTSEKSFLETANWLSQL---------RTHAYSEDP 128

  Fly   128 SPPSPLSSFSTDNLGTDGHILFDMEEFLGATQTPILVMGTKLDLLDEKRHPKMGVKKPGGIADKC 192
            .                                 :::.|.|.|||      ::.|.....:|..|
  Fly   129 D---------------------------------VVLCGNKCDLL------QLRVVSRDQVAALC 154

  Fly   193 GAEEIWLNCRNSRSLAAGTTDAVKL--SRFFDRVIEN 227
            ....: .....|....|...:||:|  .|..:| |||
  Fly   155 RRYRL-PYIETSACTGANVKEAVELLVGRVMER-IEN 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4789NP_573166.1 P-loop_NTPase 7..228 CDD:304359 52/232 (22%)
Rab27NP_726743.1 P-loop_NTPase 19..187 CDD:304359 49/228 (21%)
RAB 20..186 CDD:197555 48/225 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454560
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.