DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4789 and Rasef

DIOPT Version :10

Sequence 1:NP_573166.1 Gene:CG4789 / 32668 FlyBaseID:FBgn0030792 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001264263.1 Gene:Rasef / 298138 RGDID:1306418 Length:709 Species:Rattus norvegicus


Alignment Length:230 Identity:52/230 - (22%)
Similarity:90/230 - (39%) Gaps:68/230 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RIVVVGDSGVGKTSLTHLITHNEALIRPGWTVGCNIQVKMHPFREGTARECPYFVELFDVGGSLN 72
            :||:.||:.|||:|....:..||.......|:|.:.|:|. ...:|.    |..::|:|..|...
  Rat   512 KIVLAGDAAVGKSSFLMRLCKNEFQGNTSATLGVDFQMKT-LMVDGE----PTVLQLWDTAGQER 571

  Fly    73 HKNTRSVFYAGIDGIILVHDLTNAKSQRQLIDWLYEIVNKEGKDTNKSNGASMPPSPPSPLSSFS 137
            .::....::...||::|::|:|..||...:.:|:..:  ::|  |::|                 
  Rat   572 FRSIAKSYFRKADGVLLLYDVTCEKSFLNVREWVAMV--EDG--THRS----------------- 615

  Fly   138 TDNLGTDGHILFDMEEFLGATQTPILVMGTKLDLLDE---------KRHPKMGVKKPGGIADKCG 193
                                  .||:::|.|.||.|.         ..|  :|.|    :|...|
  Rat   616 ----------------------VPIMLVGNKADLRDAATAENQKCISSH--LGEK----LAMTYG 652

  Fly   194 AEEIWLNCRNSRSLAAGTTDAV-KLSRFFDRVIEN 227
            |    |.|..|....:...:|| .|:|...:..||
  Rat   653 A----LFCETSAKDGSNVVEAVLHLAREVKKRAEN 683

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4789NP_573166.1 P-loop containing Nucleoside Triphosphate Hydrolases 7..228 CDD:476819 52/230 (23%)
RasefNP_001264263.1 FRQ1 <1..73 CDD:444056
SMC_prok_B <141..>321 CDD:274008
Rab 511..675 CDD:206640 49/220 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.