DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4789 and RABL3

DIOPT Version :9

Sequence 1:NP_573166.1 Gene:CG4789 / 32668 FlyBaseID:FBgn0030792 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001350894.1 Gene:RABL3 / 285282 HGNCID:18072 Length:250 Species:Homo sapiens


Alignment Length:277 Identity:116/277 - (41%)
Similarity:162/277 - (58%) Gaps:50/277 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAMNNRVRIVVVGDSGVGKTSLTHLITHNEALIRPGWTVGCNIQVKMHPFREGTARECPYFVELF 65
            ||..:||:::|:|||||||:||.||:..|:.|..|.|||||::.|::|.::|||..|..|::||:
Human     1 MASLDRVKVLVLGDSGVGKSSLVHLLCQNQVLGNPSWTVGCSVDVRVHDYKEGTPEEKTYYIELW 65

  Fly    66 DVGGSLNH----KNTRSVFYAGIDGIILVHDLTNAKSQRQLIDWLYEIVNKEGKDTNKSNGASMP 126
            |||||:..    |:||:|||..::|||.||||||.||.:.|..|..|.:|::           :.
Human    66 DVGGSVGSASSVKSTRAVFYNSVNGIIFVHDLTNKKSSQNLRRWSLEALNRD-----------LV 119

  Fly   127 PSPPSPLSSFSTDNLGTDGHILFDMEEFLGATQTPILVMGTKLDLLDE-KRHPKMGVKKPGGIAD 190
            |          |..|.|:|.  :|.|:| ...|.|:||:|||||.:.| |||..:  .:...:|:
Human   120 P----------TGVLVTNGD--YDQEQF-ADNQIPLLVIGTKLDQIHETKRHEVL--TRTAFLAE 169

  Fly   191 KCGAEEIWLNCRNSRSLAAGTTDAVKLSRFFDRVIENRKALRAALAFGVSSSNAVSP-------- 247
            ....|||.|:|.|.|.||||:::|||||||||:|||.|..||.      .:...:||        
Human   170 DFNPEEINLDCTNPRYLAAGSSNAVKLSRFFDKVIEKRYFLRE------GNQMTLSPICWEMFSI 228

  Fly   248 -----PDRRRFGPTSAK 259
                 |||:|||..:.|
Human   229 WIPGFPDRKRFGAGTLK 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4789NP_573166.1 P-loop_NTPase 7..228 CDD:304359 101/225 (45%)
RABL3NP_001350894.1 RabL3 7..210 CDD:206689 102/228 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 121 1.000 Domainoid score I5735
eggNOG 1 0.900 - - E1_2CN0E
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12171
Inparanoid 1 1.050 188 1.000 Inparanoid score I3930
Isobase 1 0.950 - 0 Normalized mean entropy S2695
OMA 1 1.010 - - QHG49110
OrthoDB 1 1.010 - - D1269342at2759
OrthoFinder 1 1.000 - - FOG0005865
OrthoInspector 1 1.000 - - oto88406
orthoMCL 1 0.900 - - OOG6_105341
Panther 1 1.100 - - LDO PTHR24073
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4259
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.790

Return to query results.
Submit another query.