DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sap30 and SAP30

DIOPT Version :9

Sequence 1:NP_001285352.1 Gene:Sap30 / 32664 FlyBaseID:FBgn0030788 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_003855.1 Gene:SAP30 / 8819 HGNCID:10532 Length:220 Species:Homo sapiens


Alignment Length:151 Identity:81/151 - (53%)
Similarity:111/151 - (73%) Gaps:4/151 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 QTCCLIDDMERCRNQAGYASYSKRIQKTVAQKRLKLSSDPAAQHIYICDHHKERIQSVRTKRRRK 82
            |.|||.:|.|||...||.||:||||||:::||::|:..|.:|:|:||||:||..|||||.:|:||
Human    65 QLCCLREDGERCGRAAGNASFSKRIQKSISQKKVKIELDKSARHLYICDYHKNLIQSVRNRRKRK 129

  Fly    83 DSEDDSNET---DTDLHEFPDLYQLGVSTLRRYKRHFKVQTRQGMKRAQLADTIMKHFKTIPIKE 144
            .|:||..::   |.|..|. |||||.|:||||||||||:.||.|:.:|||.:.:..||::||:.|
Human   130 GSDDDGGDSPVQDIDTPEV-DLYQLQVNTLRRYKRHFKLPTRPGLNKAQLVEIVGCHFRSIPVNE 193

  Fly   145 KEIITFFVYMVKMGSNKLDQK 165
            |:.:|:|:|.||...||.|.|
Human   194 KDTLTYFIYSVKNDKNKSDLK 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sap30NP_001285352.1 zf-SAP30 16..86 CDD:404707 39/67 (58%)
SAP30_Sin3_bdg 104..156 CDD:404708 27/51 (53%)
SAP30NP_003855.1 Interaction with NCOR1. /evidence=ECO:0000250 1..129 36/63 (57%)
zf-SAP30 65..133 CDD:404707 39/67 (58%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 123..143 7/19 (37%)
Interaction with SIN3A. /evidence=ECO:0000250 130..220 43/86 (50%)
SAP30_Sin3_bdg 153..205 CDD:404708 27/51 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143477
Domainoid 1 1.000 94 1.000 Domainoid score I7487
eggNOG 1 0.900 - - E1_28PSY
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 190 1.000 Inparanoid score I3889
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48250
OrthoDB 1 1.010 - - D1520155at2759
OrthoFinder 1 1.000 - - FOG0004254
OrthoInspector 1 1.000 - - otm42090
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13286
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2991
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.870

Return to query results.
Submit another query.