DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sap30 and AT1G75060

DIOPT Version :9

Sequence 1:NP_001285352.1 Gene:Sap30 / 32664 FlyBaseID:FBgn0030788 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_177643.1 Gene:AT1G75060 / 843844 AraportID:AT1G75060 Length:242 Species:Arabidopsis thaliana


Alignment Length:110 Identity:31/110 - (28%)
Similarity:48/110 - (43%) Gaps:21/110 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 AQKRLKLSSDPAAQHIY---ICDHHKERIQSVRTKRRRKDSEDDSNETDTDLHEFPDLYQLGVST 108
            ::||...||..:.:.:|   .||.| .:|.|:..:...|                .||.:|.::.
plant   130 SKKRGHRSSRLSQKALYREVSCDSH-SKISSITPRLNMK----------------VDLTKLDMAA 177

  Fly   109 LRRYKRHFK-VQTRQGMKRAQLADTIMKHFKTIPIKEKEIITFFV 152
            |.||.|||. |.......:.||.|.|.:||.:..:.|.::|..||
plant   178 LLRYWRHFNLVDALPNPTKEQLIDIIQRHFMSQQMDELQVIVGFV 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sap30NP_001285352.1 zf-SAP30 16..86 CDD:404707 11/41 (27%)
SAP30_Sin3_bdg 104..156 CDD:404708 18/50 (36%)
AT1G75060NP_177643.1 SAP30_Sin3_bdg 173..225 CDD:404708 18/50 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13286
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
22.060

Return to query results.
Submit another query.