DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sap30 and Sap30

DIOPT Version :9

Sequence 1:NP_001285352.1 Gene:Sap30 / 32664 FlyBaseID:FBgn0030788 Length:173 Species:Drosophila melanogaster
Sequence 2:XP_038950841.1 Gene:Sap30 / 680122 RGDID:1595501 Length:220 Species:Rattus norvegicus


Alignment Length:155 Identity:82/155 - (52%)
Similarity:111/155 - (71%) Gaps:4/155 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 QTCCLIDDMERCRNQAGYASYSKRIQKTVAQKRLKLSSDPAAQHIYICDHHKERIQSVRTKRRRK 82
            |.|||.:|.|||...||.||:||||||:::||::|:..|.:|:|:||||:||..|||||.:|:||
  Rat    65 QLCCLREDGERCGRAAGNASFSKRIQKSISQKKVKIELDKSARHLYICDYHKNLIQSVRNRRKRK 129

  Fly    83 DSEDDSNET---DTDLHEFPDLYQLGVSTLRRYKRHFKVQTRQGMKRAQLADTIMKHFKTIPIKE 144
            .|:||..::   |.|..|. |||||.|:||||||||||:.||.|:.:|||.:.:..|||:||:.|
  Rat   130 GSDDDGGDSPVQDIDTPEV-DLYQLQVNTLRRYKRHFKLPTRPGLNKAQLVEIVGCHFKSIPVNE 193

  Fly   145 KEIITFFVYMVKMGSNKLDQKNGLG 169
            |:.:|.|:|.|:...||.|.|...|
  Rat   194 KDTLTCFIYSVRNDKNKSDLKADSG 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sap30NP_001285352.1 zf-SAP30 16..86 CDD:404707 39/67 (58%)
SAP30_Sin3_bdg 104..156 CDD:404708 28/51 (55%)
Sap30XP_038950841.1 zf-SAP30 65..133 CDD:404707 39/67 (58%)
SAP30_Sin3_bdg 153..205 CDD:404708 28/51 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 93 1.000 Domainoid score I7373
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 186 1.000 Inparanoid score I3832
OMA 1 1.010 - - QHG48250
OrthoDB 1 1.010 - - D1520155at2759
OrthoFinder 1 1.000 - - FOG0004254
OrthoInspector 1 1.000 - - otm46239
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13286
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2991
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1111.080

Return to query results.
Submit another query.