DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sap30 and Sap30

DIOPT Version :9

Sequence 1:NP_001285352.1 Gene:Sap30 / 32664 FlyBaseID:FBgn0030788 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_068560.1 Gene:Sap30 / 60406 MGIID:1929129 Length:220 Species:Mus musculus


Alignment Length:155 Identity:82/155 - (52%)
Similarity:111/155 - (71%) Gaps:4/155 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 QTCCLIDDMERCRNQAGYASYSKRIQKTVAQKRLKLSSDPAAQHIYICDHHKERIQSVRTKRRRK 82
            |.|||.:|.|||...||.||:||||||:::||::|:..|.:|:|:||||:||..|||||.:|:||
Mouse    65 QLCCLREDGERCGRAAGNASFSKRIQKSISQKKVKIELDKSARHLYICDYHKNLIQSVRNRRKRK 129

  Fly    83 DSEDDSNET---DTDLHEFPDLYQLGVSTLRRYKRHFKVQTRQGMKRAQLADTIMKHFKTIPIKE 144
            .|:||..::   |.|..|. |||||.|:||||||||||:.||.|:.:|||.:.:..|||:||:.|
Mouse   130 GSDDDGGDSPVQDIDTPEV-DLYQLQVNTLRRYKRHFKLPTRPGLNKAQLVEIVGCHFKSIPVNE 193

  Fly   145 KEIITFFVYMVKMGSNKLDQKNGLG 169
            |:.:|.|:|.|:...||.|.|...|
Mouse   194 KDTLTCFIYSVRNDKNKSDLKADSG 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sap30NP_001285352.1 zf-SAP30 16..86 CDD:404707 39/67 (58%)
SAP30_Sin3_bdg 104..156 CDD:404708 28/51 (55%)
Sap30NP_068560.1 Interaction with NCOR1. /evidence=ECO:0000269|PubMed:9702189 1..129 36/63 (57%)
zf-SAP30 65..133 CDD:404707 39/67 (58%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 123..143 9/22 (41%)
Interaction with SIN3A. /evidence=ECO:0000269|PubMed:9702189 130..220 44/90 (49%)
SAP30_Sin3_bdg 153..205 CDD:404708 28/51 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833634
Domainoid 1 1.000 92 1.000 Domainoid score I7586
eggNOG 1 0.900 - - E1_28PSY
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 186 1.000 Inparanoid score I3914
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48250
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004254
OrthoInspector 1 1.000 - - otm44144
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13286
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2991
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.860

Return to query results.
Submit another query.