DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sap30 and sap30

DIOPT Version :9

Sequence 1:NP_001285352.1 Gene:Sap30 / 32664 FlyBaseID:FBgn0030788 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_001016618.1 Gene:sap30 / 549372 XenbaseID:XB-GENE-942260 Length:194 Species:Xenopus tropicalis


Alignment Length:155 Identity:81/155 - (52%)
Similarity:111/155 - (71%) Gaps:4/155 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 QTCCLIDDMERCRNQAGYASYSKRIQKTVAQKRLKLSSDPAAQHIYICDHHKERIQSVRTKRRRK 82
            |.|||.::.|||...||.||:||||||:::||::|:..|..|:|:||||.||..|||||.:|:||
 Frog    39 QVCCLREEGERCNRPAGNASFSKRIQKSISQKKVKIDLDKTARHLYICDFHKNLIQSVRNRRKRK 103

  Fly    83 DSEDDSNET---DTDLHEFPDLYQLGVSTLRRYKRHFKVQTRQGMKRAQLADTIMKHFKTIPIKE 144
            .|:||..::   |.|..|. ||:||.|:||||||||||:|.|.|:.:|||.:.|..||:|:|:.|
 Frog   104 GSDD
DGGDSPVHDADTPEV-DLFQLQVNTLRRYKRHFKLQARPGLNKAQLVEIIGCHFRTLPVNE 167

  Fly   145 KEIITFFVYMVKMGSNKLDQKNGLG 169
            |:.:|:|:..||...||||.|:..|
 Frog   168 KDTLTYFICSVKNEKNKLDHKSDGG 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sap30NP_001285352.1 zf-SAP30 16..86 CDD:404707 38/67 (57%)
SAP30_Sin3_bdg 104..156 CDD:404708 27/51 (53%)
sap30NP_001016618.1 zf-SAP30 37..107 CDD:290577 38/67 (57%)
SAP30_Sin3_bdg 128..176 CDD:290578 26/47 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 96 1.000 Domainoid score I7209
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 189 1.000 Inparanoid score I3774
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1520155at2759
OrthoFinder 1 1.000 - - FOG0004254
OrthoInspector 1 1.000 - - otm49322
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2991
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.