DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sap30 and LOC103910016

DIOPT Version :9

Sequence 1:NP_001285352.1 Gene:Sap30 / 32664 FlyBaseID:FBgn0030788 Length:173 Species:Drosophila melanogaster
Sequence 2:XP_009296678.3 Gene:LOC103910016 / 103910016 -ID:- Length:140 Species:Danio rerio


Alignment Length:139 Identity:76/139 - (54%)
Similarity:99/139 - (71%) Gaps:10/139 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 NGFSTGEEDSRG------HTDQTCCLIDDMERCRNQAGYASYSKRIQKTVAQKRLKLSSDPAAQH 61
            ||||| ||||..      ...|:||||:|.|||...||.||:||||||:::|::|||..|.:.:|
Zfish     2 NGFST-EEDSHDGPPAPPFFGQSCCLIEDAERCGRPAGNASFSKRIQKSISQRKLKLDIDKSVRH 65

  Fly    62 IYICDHHKERIQSVRTKRRRKDSEDDSNETDTDLHEFP--DLYQLGVSTLRRYKRHFKVQTRQGM 124
            :||||.||..|||||.||:||.|:|.....|.:: |.|  ||:||.|:||||||||:|:|||.|:
Zfish    66 LYICDFHKNFIQSVRNKRKRKTSDDGGESPDHEV-EVPEVDLFQLQVNTLRRYKRHYKIQTRPGL 129

  Fly   125 KRAQLADTI 133
            .:||||:.:
Zfish   130 NKAQLAEVL 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sap30NP_001285352.1 zf-SAP30 16..86 CDD:404707 41/69 (59%)
SAP30_Sin3_bdg 104..156 CDD:404708 19/30 (63%)
LOC103910016XP_009296678.3 zf-SAP30 20..90 CDD:316389 41/69 (59%)
SAP30_Sin3_bdg 109..>139 CDD:316390 19/30 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576351
Domainoid 1 1.000 95 1.000 Domainoid score I7358
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 189 1.000 Inparanoid score I3883
OMA 1 1.010 - - QHG48250
OrthoDB 1 1.010 - - D1520155at2759
OrthoFinder 1 1.000 - - FOG0004254
OrthoInspector 1 1.000 - - otm25695
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13286
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2991
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1111.010

Return to query results.
Submit another query.