DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9609 and znf711

DIOPT Version :9

Sequence 1:NP_573161.1 Gene:CG9609 / 32663 FlyBaseID:FBgn0030787 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001352539.1 Gene:znf711 / 562505 ZFINID:ZDB-GENE-081107-49 Length:765 Species:Danio rerio


Alignment Length:385 Identity:90/385 - (23%)
Similarity:140/385 - (36%) Gaps:110/385 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 EEFKQR-------QGRRNSIGSAKYACSMPKCEATFKRL----DQLDRHE--------------- 56
            ::||.|       :...:.:...||.|:  .||.|..:.    :.|:.|:               
Zfish   394 KKFKSRGFLKRHMKNHPDHMFKKKYQCT--DCEFTTNKKVSFHNHLESHKLIIKNEKIPEYTEYT 456

  Fly    57 --YHHTG-------------IKKHACSYEGCDKTYSIVTHLKRHLRSTHERPESAAKKTVKCALE 106
              ||...             .|.|.|.|  |:...:....|.|||.:.|       .|.......
Zfish   457 RRYHEASPLSSNKLILRDKEPKLHKCKY--CEYETAEQGLLNRHLLAVH-------SKNFAHVCV 512

  Fly   107 ECSKMFISVSNMTRHMRETHESPKVYPCSQCSAKFSQKLKLKRHEIREHTLEYPYSCSKCSRGFY 171
            ||:|.|...|.:.:||| ||...|.:.|..|....:.:..||.|...:|..:.|:.|..|.:.|.
Zfish   513 ECAKGFRHPSELKKHMR-THTGEKPFHCQHCEFSCADQSNLKTHIKSKHGTDLPFKCGHCPQAFA 576

  Fly   172 QQWQCQSHE---PSCKLYECPGCPLQFDKWTLYTKHCRDSLHGKN-RHKCDRCDSAFDKPSELKR 232
            ...:.|.|.   ...|.::||.|..:....:...:|. .|:|.|: .||||.|:..|.:|||||:
Zfish   577 DDKELQRHAEIFQGHKTHQCPHCEHKSTNSSDLKRHI-ISVHTKDFPHKCDVCEKGFHRPSELKK 640

  Fly   233 HLEV---------KHKEAAQTDECATS------------FTCNEEGCGKSYSYLRNLRQHMLTAH 276
            |.|.         :|.:....|....|            |.|..  |.:.:.:...|::||.| |
Zfish   641 HSETHKGNKVHQCRHCDFKTLDPFTLSRHILSVHTKDLPFKCKR--CKRGFRHQNELKKHMKT-H 702

  Fly   277 SGRR-FECQALD---------------------------CGRCFSSAQNLARHLLRDHKD 308
            |||: ::||..:                           |.:.|.......:|::|.||:
Zfish   703 SGRKVYQCQYCEYNTTDASGFKRHVISIHTKDYPHRCDYCKKGFRRPSEKNQHIMRHHKE 762

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9609NP_573161.1 C2H2 Zn finger 40..59 CDD:275368 6/39 (15%)
zf-C2H2_8 67..150 CDD:292531 24/82 (29%)
C2H2 Zn finger 67..90 CDD:275368 7/22 (32%)
C2H2 Zn finger 106..126 CDD:275368 8/19 (42%)
C2H2 Zn finger 134..155 CDD:275368 5/20 (25%)
C2H2 Zn finger 188..210 CDD:275368 5/21 (24%)
C2H2 Zn finger 217..237 CDD:275368 11/28 (39%)
C2H2 Zn finger 253..276 CDD:275368 6/22 (27%)
C2H2 Zn finger 283..302 CDD:275368 4/45 (9%)
znf711NP_001352539.1 Zfx_Zfy_act 64..368 CDD:309717
COG5048 385..763 CDD:227381 90/385 (23%)
C2H2 Zn finger 389..409 CDD:275368 3/14 (21%)
C2H2 Zn finger 482..503 CDD:275368 7/22 (32%)
C2H2 Zn finger 511..531 CDD:275368 8/20 (40%)
C2H2 Zn finger 539..560 CDD:275368 5/20 (25%)
C2H2 Zn finger 568..584 CDD:275368 4/15 (27%)
C2H2 Zn finger 596..617 CDD:275368 5/21 (24%)
C2H2 Zn finger 625..645 CDD:275368 11/19 (58%)
C2H2 Zn finger 682..702 CDD:275368 6/22 (27%)
C2H2 Zn finger 710..731 CDD:275368 2/20 (10%)
C2H2 Zn finger 739..759 CDD:275368 3/19 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.