DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9609 and znf532

DIOPT Version :9

Sequence 1:NP_573161.1 Gene:CG9609 / 32663 FlyBaseID:FBgn0030787 Length:403 Species:Drosophila melanogaster
Sequence 2:XP_005161130.1 Gene:znf532 / 559908 ZFINID:ZDB-GENE-060531-40 Length:1294 Species:Danio rerio


Alignment Length:482 Identity:101/482 - (20%)
Similarity:170/482 - (35%) Gaps:158/482 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 QGRRNSI------GSAKYACSMP-------KCEATFKRLDQLDRHEYHHTGIKKHACSYEGCDKT 75
            ||:.||.      .||....:||       .|.:..|.|:                     |::|
Zfish   696 QGKGNSTTVISAPSSAPVVAAMPLDKDASRVCRSNLKCLE---------------------CNET 739

  Fly    76 YSIVTHLKRHLRSTHERPESAAKKTVKCALEECSKMFISVSNMTRHMR-ETHESPKVYPCSQCSA 139
            :...:.|..|.:   :.|||:.:||  |.:  |..:..:..:...|.| ..|:||  |.|.:|.|
Zfish   740 FQEESALVMHYQ---QAPESSGQKT--CTI--CQMLLPNQCSFASHQRIHQHKSP--YICPECGA 795

  Fly   140 KFSQKLKLKRHEIREHTLEYP----YSCSKCSRGFYQQWQCQSH--EPSCKL-YECPGCPLQFDK 197
             ..:.:..:.| :.::.|.|.    |.|..||..|......:||  ...|:: |:||.||:.|..
Zfish   796 -ICRSVHFQSH-VTKNCLHYTRRVGYRCVHCSVIFADVAALKSHIQGSHCEIFYKCPICPMAFKS 858

  Fly   198 WT-----LYTKHCRDSL-HGKNRHKCDRCDSAFDKPSELKRHLEVKHKEAAQTDECATSFTCNEE 256
            ..     .||:|....: ..|..:||..||:.|.:.:.|..|.: :|..:.:    .:.|.|.: 
Zfish   859 APGAHSHAYTQHPGVKIGEPKLIYKCSMCDTVFTQQTLLYTHFD-QHISSQK----VSVFKCPD- 917

  Fly   257 GCGKSYSYLRNLRQHMLTAH--------------------------------------------S 277
             |...|:..:.:..|:.:.|                                            .
Zfish   918 -CSVHYAQKQLMLDHIKSMHGTLKTIEGPPNLGINLPLSSKPTNSLSPNNNSNNKESSSISNLEK 981

  Fly   278 GRR---------------------------FECQALDCGRCFSSAQNLARHLLRDHKDGATKKEL 315
            |.:                           :.|:  ||.|.|:..:....|:.|:|     .|:|
Zfish   982 GEKKPVSPTKKSSNGTDIPKKPPPSTSCPGWNCR--DCDRLFTQREVYISHMKREH-----GKQL 1039

  Fly   316 KAKKKDKSKTGEGGKTKSTSRKRRRDAGRSKHSRLSKLACLQLDKEDDEAVRERQPLVLEK---I 377
            |     |....:..|:.|:|....|. .|.||..|.|:.......:......:|  |:|||   :
Zfish  1040 K-----KHPCRQCEKSFSSSHSLCRH-NRIKHKGLRKVYSCPHCPDPSRTFTKR--LLLEKHIHL 1096

  Fly   378 TQSLKDDPVEELLAQTLQDE--EEKEQ 402
            ..::|:.. ::|.|.:..:|  .||||
Zfish  1097 MHTVKETE-DKLPADSSSNEATAEKEQ 1122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9609NP_573161.1 C2H2 Zn finger 40..59 CDD:275368 4/25 (16%)
zf-C2H2_8 67..150 CDD:292531 20/83 (24%)
C2H2 Zn finger 67..90 CDD:275368 4/22 (18%)
C2H2 Zn finger 106..126 CDD:275368 3/20 (15%)
C2H2 Zn finger 134..155 CDD:275368 4/20 (20%)
C2H2 Zn finger 188..210 CDD:275368 8/27 (30%)
C2H2 Zn finger 217..237 CDD:275368 6/19 (32%)
C2H2 Zn finger 253..276 CDD:275368 4/22 (18%)
C2H2 Zn finger 283..302 CDD:275368 5/18 (28%)
znf532XP_005161130.1 C2H2 Zn finger 733..756 CDD:275368 6/46 (13%)
C2H2 Zn finger 762..782 CDD:275368 4/21 (19%)
C2H2 Zn finger 790..812 CDD:275368 4/23 (17%)
zf-C2H2_2 <809..848 CDD:289522 10/38 (26%)
C2H2 Zn finger 821..838 CDD:275368 5/16 (31%)
C2H2 Zn finger 849..874 CDD:275368 8/24 (33%)
C2H2 Zn finger 884..904 CDD:275368 6/20 (30%)
C2H2 Zn finger 1014..1034 CDD:275368 6/21 (29%)
C2H2 Zn finger 1044..1065 CDD:275368 5/21 (24%)
C2H2 Zn finger 1074..1096 CDD:275368 5/23 (22%)
C2H2 Zn finger 1177..1197 CDD:275368
zf-C2H2_11 1200..1228 CDD:293228
C2H2 Zn finger 1206..1238 CDD:275368
C2H2 Zn finger 1259..1279 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579992
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.