DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG9609 and si:ch211-89o9.6

DIOPT Version :9

Sequence 1:	NP_573161.1	Gene:	CG9609 / 32663	FlyBaseID:	FBgn0030787	Length:	403	Species:	Drosophila melanogaster
Sequence 2:	XP_687655.4	Gene:	si:ch211-89o9.6 / 559243	ZFINID:	ZDB-GENE-030131-7155	Length:	582	Species:	Danio rerio

Alignment Length:	94	Identity:	29/94 - (30%)
Similarity:	49/94 - (52%)	Gaps:	8/94 - (8%)

- Green bases have known domain annotations that are detailed below.

  Fly    91 ERPESAAKKTVKCALEECSKMFISVSNMTRHMRETHESPKVYPCSQCSAKFSQKLKLKRHEIREH 155
            :|.|...:::..|  :.|.|.|..:||:..|.| .|...:.:.|..|...|::...||:|: |.|
Zfish   489 KRMEKGRRRSYVC--KYCGKAFPGLSNVVAHQR-VHTGERPFRCDICGKLFAEAGNLKKHQ-RVH 549

  Fly   156 TLEYPYSCSKCSRGFYQQWQC--QSHEPS 182
            |.|.|::|.:|.:.|  .|.|  ::|:.|
Zfish   550 TGEKPFTCPRCGKQF--AWICNLKTHQQS 576

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG9609	NP_573161.1	C2H2 Zn finger	40..59	CDD:275368
		zf-C2H2_8	67..150	CDD:292531	16/58 (28%)
		C2H2 Zn finger	67..90	CDD:275368
		C2H2 Zn finger	106..126	CDD:275368	7/19 (37%)
		C2H2 Zn finger	134..155	CDD:275368	7/20 (35%)
		C2H2 Zn finger	188..210	CDD:275368
		C2H2 Zn finger	217..237	CDD:275368
		C2H2 Zn finger	253..276	CDD:275368
		C2H2 Zn finger	283..302	CDD:275368
si:ch211-89o9.6	XP_687655.4	COG5048	<364..>558	CDD:227381	22/72 (31%)
		zf-C2H2	499..521	CDD:278523	8/24 (33%)
		C2H2 Zn finger	501..521	CDD:275368	8/22 (36%)
		zf-H2C2_2	517..537	CDD:290200	5/20 (25%)
		C2H2 Zn finger	529..549	CDD:275368	7/20 (35%)
		zf-H2C2_2	541..565	CDD:290200	11/26 (42%)
		C2H2 Zn finger	557..574	CDD:275368	5/18 (28%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C170579991
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.930