DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9609 and CG4424

DIOPT Version :9

Sequence 1:NP_573161.1 Gene:CG9609 / 32663 FlyBaseID:FBgn0030787 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_650859.3 Gene:CG4424 / 42390 FlyBaseID:FBgn0038765 Length:345 Species:Drosophila melanogaster


Alignment Length:177 Identity:47/177 - (26%)
Similarity:69/177 - (38%) Gaps:42/177 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 KKHACSY--EGCDKTYSIVTHLKRHLRSTHERPESAAKKTVKCALEECSKMFISVSNMTRHMRET 125
            |.|.|:.  .|..:..::.||::||   ..|||       .:|  |.|.|.|.....:.||:|: 
  Fly   185 KLHVCAICGNGYPRKSTLDTHMRRH---NDERP-------YEC--EICHKSFHVNYQLKRHIRQ- 236

  Fly   126 HESPKVYPCSQCSAKFSQKLKLKRHEIREHTLEYPYSCSKCSRGFYQQWQCQSHEPSCKLYECPG 190
            |...|.|.|..|...|:.:..|.:|| |.|..|.||:|..|.:.|......:.|           
  Fly   237 HTGAKPYTCQYCQRNFADRTSLVKHE-RTHRNERPYACKTCGKKFTYASVLKMH----------- 289

  Fly   191 CPLQFDKWTLYTKHCRDSLHGKNRHKCDRCDSAFDKPSELKRHLEVK 237
                      |..|.     |:..|.|..|:.:|.:...|..||:.:
  Fly   290 ----------YKTHT-----GEKPHICQLCNKSFARIHNLVAHLQTQ 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9609NP_573161.1 C2H2 Zn finger 40..59 CDD:275368
zf-C2H2_8 67..150 CDD:292531 24/84 (29%)
C2H2 Zn finger 67..90 CDD:275368 6/24 (25%)
C2H2 Zn finger 106..126 CDD:275368 7/19 (37%)
C2H2 Zn finger 134..155 CDD:275368 7/20 (35%)
C2H2 Zn finger 188..210 CDD:275368 2/21 (10%)
C2H2 Zn finger 217..237 CDD:275368 6/19 (32%)
C2H2 Zn finger 253..276 CDD:275368
C2H2 Zn finger 283..302 CDD:275368
CG4424NP_650859.3 zf-AD 10..92 CDD:285071
C2H2 Zn finger 189..209 CDD:275368 4/19 (21%)
DUF45 <204..281 CDD:302795 31/90 (34%)
COG5048 210..>345 CDD:227381 39/149 (26%)
C2H2 Zn finger 217..237 CDD:275368 8/22 (36%)
C2H2 Zn finger 245..265 CDD:275368 7/20 (35%)
zf-H2C2_2 257..282 CDD:290200 11/25 (44%)
C2H2 Zn finger 273..293 CDD:275368 5/40 (13%)
zf-H2C2_2 286..310 CDD:290200 8/49 (16%)
C2H2 Zn finger 301..320 CDD:275368 6/18 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.