DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9609 and az2

DIOPT Version :9

Sequence 1:NP_573161.1 Gene:CG9609 / 32663 FlyBaseID:FBgn0030787 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_610289.2 Gene:az2 / 35682 FlyBaseID:FBgn0025185 Length:593 Species:Drosophila melanogaster


Alignment Length:307 Identity:68/307 - (22%)
Similarity:115/307 - (37%) Gaps:58/307 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 KYACSMPKCEATFKRLDQLDRHEYHHTGIKKHACSYEGCDKTYSIVTHLKRHLRSTHE------- 91
            |:.|::...:::...:..|...|: ..|:..|   |:..|...|:.....|.:::..:       
  Fly   292 KHFCNLNVRKSSLIEITDLLTSEF-SLGLVTH---YDVYDSIQSMRQWYSRRIKTLTDVQCVGLS 352

  Fly    92 -------------RPESAAKKTVKCALEECSKMFISVSNMTRHMRETHE--SPKVYPCSQCSAKF 141
                         .|..:.::.:||  |.|...|.:...:..|....|:  ....:.|:.|...|
  Fly   353 LAEKQYIERCNSFMPTKSFRQKLKC--EVCEHSFSTDHALQAHQFRDHKMGDGGWFRCTLCELNF 415

  Fly   142 SQKLKLKRHEIREHTLEYPYSCSKCSRGFYQQWQCQSHEPS------CKLYECPGCPLQFDKWTL 200
            .:|..|::|..|.| ::..:.|..|||.|....|...|:.:      .|.:.|..|...|.:...
  Fly   416 DRKCHLQQHSQRVH-MDKSFVCEICSRSFAFGNQLAIHKRTHDEKHVAKPFVCEFCGKCFKQKIQ 479

  Fly   201 YTKHCRDSLHGKNR-HKCDRCDSAF----DKPSELKRHLEVKHKEAAQTDECATSFTCNEEGCGK 260
            .|.|. .::|.|.| .|||.|...|    |....:|.||.::.|            .|  |.|.|
  Fly   480 MTTHV-TAVHTKIRAFKCDMCPKDFLTKRDLKDHVKAHLNIRDK------------VC--EVCQK 529

  Fly   261 SYSYLRNLRQHMLTAHSGRRFECQALDCGRCFSSAQNLARHLLRDHK 307
            :::....|.:|. ..|..:..:|..  |...||...:|..|:.|.||
  Fly   530 AFTNANALVKHR-HIHKEKTLQCSL--CTTRFSERVSLGVHMRRTHK 573

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9609NP_573161.1 C2H2 Zn finger 40..59 CDD:275368 2/18 (11%)
zf-C2H2_8 67..150 CDD:292531 17/104 (16%)
C2H2 Zn finger 67..90 CDD:275368 4/22 (18%)
C2H2 Zn finger 106..126 CDD:275368 4/19 (21%)
C2H2 Zn finger 134..155 CDD:275368 7/20 (35%)
C2H2 Zn finger 188..210 CDD:275368 5/21 (24%)
C2H2 Zn finger 217..237 CDD:275368 8/23 (35%)
C2H2 Zn finger 253..276 CDD:275368 6/22 (27%)
C2H2 Zn finger 283..302 CDD:275368 5/18 (28%)
az2NP_610289.2 MADF_DNA_bdg 157..242 CDD:287510
GT1 276..>341 CDD:304916 10/52 (19%)
C2H2 Zn finger 377..398 CDD:275368 5/22 (23%)
C2H2 Zn finger 408..429 CDD:275368 7/20 (35%)
C2H2 Zn finger 436..456 CDD:275368 7/19 (37%)
C2H2 Zn finger 467..488 CDD:275368 5/21 (24%)
C2H2 Zn finger 496..516 CDD:275368 6/19 (32%)
C2H2 Zn finger 524..544 CDD:275368 6/22 (27%)
C2H2 Zn finger 551..572 CDD:275368 7/22 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.