DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9609 and CG30431

DIOPT Version :9

Sequence 1:NP_573161.1 Gene:CG9609 / 32663 FlyBaseID:FBgn0030787 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_610211.1 Gene:CG30431 / 35549 FlyBaseID:FBgn0050431 Length:418 Species:Drosophila melanogaster


Alignment Length:322 Identity:75/322 - (23%)
Similarity:102/322 - (31%) Gaps:116/322 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PPGTQIASDSDMETALEEFKQRQGRRNSIGSAKYACSMPKCEATFKRLDQLDRHEYHHTGIKKHA 66
            ||....:|:.....|.|:.|.|:.|                    .|.|.:...|...:|..   
  Fly   185 PPTPPESSEEPAPDAAEKPKMRRAR--------------------PRQDNVKPKERKASGAV--- 226

  Fly    67 CSYEGCDKTYSIVTHLKRHLRSTHERPESAAKKTVKCALEECSKMFISVSNMTRHMRETHESPKV 131
                              |.||.|..|             ||.|.|.....:..||...|...::
  Fly   227 ------------------HPRSLHPCP-------------ECEKKFTRNFQLKLHMTAVHGMGEM 260

  Fly   132 -YPCSQCSAKFSQKLKLKRHEIREHTLEYPYSCSKCSRGFYQQWQCQSH------EPSCKLYECP 189
             |.|.:|...|:.:..|:.|....|:.|.|:.|..|.|.|..:.|..||      |...:::||.
  Fly   261 RYQCEECRKNFASRHSLRYHVKSVHSTERPFGCQHCDRRFILRTQLLSHLRTHTGEAKPRIFECQ 325

  Fly   190 GC----PLQFDKWTLYTKHCRDSLHGKNRH---KCDRCDSAFDKPSELKRHLEVKHKEAAQTDEC 247
            .|    |.:.|..|    |.|.  |..|..   |||||..||.....|..||.|           
  Fly   326 RCSKSWPTKSDLRT----HMRS--HNPNMERPFKCDRCSKAFFTRGHLNSHLLV----------- 373

  Fly   248 ATSFTCNEEGCGKSYSYLRNLRQHMLTAHSGRR-FECQALDCGRCFSSAQNLARHLLRDHKD 308
                                        |:|.: |.|:.  |.:|:.|..||..|::|.|.|
  Fly   374 ----------------------------HTGEKPFACEY--CDKCYQSVGNLNNHMVRLHAD 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9609NP_573161.1 C2H2 Zn finger 40..59 CDD:275368 3/18 (17%)
zf-C2H2_8 67..150 CDD:292531 17/83 (20%)
C2H2 Zn finger 67..90 CDD:275368 3/22 (14%)
C2H2 Zn finger 106..126 CDD:275368 6/19 (32%)
C2H2 Zn finger 134..155 CDD:275368 5/20 (25%)
C2H2 Zn finger 188..210 CDD:275368 7/25 (28%)
C2H2 Zn finger 217..237 CDD:275368 9/19 (47%)
C2H2 Zn finger 253..276 CDD:275368 0/22 (0%)
C2H2 Zn finger 283..302 CDD:275368 6/18 (33%)
CG30431NP_610211.1 zf-AD 11..82 CDD:285071
C2H2 Zn finger 234..255 CDD:275368 7/33 (21%)
C2H2 Zn finger 264..285 CDD:275368 5/20 (25%)
C2H2 Zn finger 293..313 CDD:275368 7/19 (37%)
zf-C2H2_8 305..373 CDD:292531 24/73 (33%)
C2H2 Zn finger 324..344 CDD:275368 7/25 (28%)
C2H2 Zn finger 354..374 CDD:275368 10/58 (17%)
zf-H2C2_2 366..389 CDD:290200 9/63 (14%)
C2H2 Zn finger 382..403 CDD:275368 8/22 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.