DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9609 and Plzf

DIOPT Version :9

Sequence 1:NP_573161.1 Gene:CG9609 / 32663 FlyBaseID:FBgn0030787 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001285862.1 Gene:Plzf / 34622 FlyBaseID:FBgn0032401 Length:469 Species:Drosophila melanogaster


Alignment Length:398 Identity:92/398 - (23%)
Similarity:135/398 - (33%) Gaps:135/398 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 IGSAKYACSMP-------------KCEATFKRLDQLDRHEYH--------HTGIKKHACSYEGCD 73
            :|.||.|..:|             |.||.|:     :|..|.        .:..|.:.|.  |||
  Fly   134 LGEAKEATEIPAPGEAQPNPDPEKKAEAVFE-----NRQSYFKLKNPRAVKSSSKVNYCI--GCD 191

  Fly    74 -KTYSIVTHLKRHLRSTHERPESAAKKTVKCALEECSKMFISVSNMTRHM-RETHESPKVYPCSQ 136
             |.|.:        :...|...|.....:.|:|  |...|:.......|: |.:.:..|.:.|.|
  Fly   192 FKCYQV--------QKMIEHMGSCEPSHLICSL--CEVGFLDWREYDTHLRRHSGDLRKPFFCLQ 246

  Fly   137 CSAKFSQKLKLKRHEIREHTLEYPYSCSKCSRGFYQQWQCQSHEPSCKLYECPGCPLQFDKWTLY 201
            |..:|:.:..|..|: .:|:.|.|:.|..|.:||                          ||.  
  Fly   247 CGIRFNTRAALLVHQ-PKHSTETPHICPHCGKGF--------------------------KWK-- 282

  Fly   202 TKHCRDSLHGKNRH----------KCDRCDSAFDKPSELKRHLEVKHKEAAQTDECATSFTCNEE 256
                    .|.:.|          .||.|..:......||.|      :...|.|   .|.|...
  Fly   283 --------QGLSNHILVHNPEKQMLCDVCGYSTTHMKALKSH------KLLHTGE---FFACTVS 330

  Fly   257 GCGKSYSYLRNLRQHMLTAHSGRRFECQALDCGRCFSSAQNLARHLLRDHKDGATKKELKAKKKD 321
            ||....:...||:.|:.|...||.|.|:.  ||..||.::||.||.|:..::|            
  Fly   331 GCKHRANRKENLKLHIETHKQGRDFICEV--CGCKFSQSKNLKRHALKHTENG------------ 381

  Fly   322 KSKTGEGGKTKSTSRKRRRDAGRSKHSRLSKLACLQLDKEDDEAVRERQPLVL---EKITQSLKD 383
                        .:|.:.:..|.|.| |..|:      ||..:.|...:|:.|   |.:..|..|
  Fly   382 ------------PNRYKCQLCGFSSH-RSDKM------KEHVQRVHTEKPVQLELSETVDSSFPD 427

  Fly   384 D---PVEE 388
            |   ||.|
  Fly   428 DFELPVIE 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9609NP_573161.1 C2H2 Zn finger 40..59 CDD:275368 7/39 (18%)
zf-C2H2_8 67..150 CDD:292531 20/84 (24%)
C2H2 Zn finger 67..90 CDD:275368 6/23 (26%)
C2H2 Zn finger 106..126 CDD:275368 4/20 (20%)
C2H2 Zn finger 134..155 CDD:275368 6/20 (30%)
C2H2 Zn finger 188..210 CDD:275368 2/21 (10%)
C2H2 Zn finger 217..237 CDD:275368 6/19 (32%)
C2H2 Zn finger 253..276 CDD:275368 7/22 (32%)
C2H2 Zn finger 283..302 CDD:275368 8/18 (44%)
PlzfNP_001285862.1 COG5048 <193..403 CDD:227381 65/298 (22%)
C2H2 Zn finger 214..234 CDD:275368 5/21 (24%)
C2H2 Zn finger 244..264 CDD:275368 6/20 (30%)
C2H2 Zn finger 272..292 CDD:275368 8/55 (15%)
C2H2 Zn finger 300..320 CDD:275368 6/25 (24%)
C2H2 Zn finger 330..349 CDD:275368 5/18 (28%)
C2H2 Zn finger 357..377 CDD:275368 10/21 (48%)
C2H2 Zn finger 387..408 CDD:275368 7/27 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.