DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9609 and CG12299

DIOPT Version :9

Sequence 1:NP_573161.1 Gene:CG9609 / 32663 FlyBaseID:FBgn0030787 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_609448.1 Gene:CG12299 / 34483 FlyBaseID:FBgn0032295 Length:736 Species:Drosophila melanogaster


Alignment Length:475 Identity:108/475 - (22%)
Similarity:184/475 - (38%) Gaps:107/475 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPPGTQIASDSDMETALEEFKQRQGRRNSIGSAK-----------YACSMPKCEATFKRLDQLDR 54
            :||...::....:::.  ..|:|:|||::||:..           :.|:  .|||:|.....|.:
  Fly   211 LPPAPTVSPGLGLQST--PIKRRRGRRSNIGAPVMDPALNGNQKCFQCT--HCEASFPNAGDLSK 271

  Fly    55 HEYHHTGIKKHACSYEGCDKTYSIVTHLKRHLR-STHERP---------------------ESAA 97
            |...|...|...||.  |.||::.:..|..|:| .:.|:|                     ..:.
  Fly   272 HVRSHITNKPFQCSI--CQKTFTHIGSLNTHIRIHSGEKPYKCELCPKAFTQSSSLMVHMRSHSV 334

  Fly    98 KKTVKCALEECSKMFISVSNMTRHMRETHESP-KVYPCSQCSAKFSQKLKLKRHEIREHTLEYPY 161
            :|..:|.  :|.|.||:.|::..| ::||.:| :.:.|.:|..:|..:..|..| :|.||.|..|
  Fly   335 RKPHQCV--QCDKGFINYSSLLLH-QKTHIAPTETFICPECEREFKAEALLDEH-MRMHTQELVY 395

  Fly   162 SCSKCSRGFYQQWQCQSHEPSC---KLYECPGCPLQFDKWTLYTKHCRDSLH-GKNRHKCDRCDS 222
            .|:.|...|....:...|..:.   |.:.|..|...|.:......|.|  :| |:...:|..||.
  Fly   396 QCAICREAFRASSELVQHMKNHMGEKPFTCSLCDRSFTQSGSLNIHMR--IHTGEKPFQCKLCDK 458

  Fly   223 AFDKPSELKRHLEVKHKEAAQTDECATSFTCNEEGCGKSYSYLRNLRQH-----MLTAHSG---- 278
            .|.:.|.|..|:::...|        ..:.|  ..||||||....|.:|     |.:|.|.    
  Fly   459 CFTQASSLSVHMKIHAGE--------KPYPC--PICGKSYSQQAYLNKHIQAHQMASAASASTSP 513

  Fly   279 ---------RRFECQALDCGRCFSSAQNLARHLLRDHKDGATKKELKAKKKDKSKTGEGGKTKST 334
                     ....|  :.||...:.|..||.|:...|     ...|...|:....|..||.....
  Fly   514 GLLVAKQPHETLVC--IVCGSLHADATALASHVHSQH-----AALLDTMKQSGMNTAPGGAIPDV 571

  Fly   335 SRKRRRDAGRSKHSRLSKLACL--QLDKEDDEAVRERQP------LVLEKITQSLKDDPVEELLA 391
                 :.:...:.:.:.::.|:  |::.:......::||      ...::..|.|:..|.:..|.
  Fly   572 -----KCSAEEQQAYVERVQCVLQQMNHQQQHQQHQQQPPQQQQQHPQQQQQQHLQQQPHQMQLP 631

  Fly   392 Q---------TLQDEEEKEQ 402
            |         |.:||||.::
  Fly   632 QQPKLPAMDSTGEDEEEPDE 651

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9609NP_573161.1 C2H2 Zn finger 40..59 CDD:275368 6/18 (33%)
zf-C2H2_8 67..150 CDD:292531 25/105 (24%)
C2H2 Zn finger 67..90 CDD:275368 8/23 (35%)
C2H2 Zn finger 106..126 CDD:275368 6/19 (32%)
C2H2 Zn finger 134..155 CDD:275368 6/20 (30%)
C2H2 Zn finger 188..210 CDD:275368 5/21 (24%)
C2H2 Zn finger 217..237 CDD:275368 7/19 (37%)
C2H2 Zn finger 253..276 CDD:275368 10/27 (37%)
C2H2 Zn finger 283..302 CDD:275368 6/18 (33%)
CG12299NP_609448.1 COG5048 <254..413 CDD:227381 43/166 (26%)
C2H2 Zn finger 256..276 CDD:275368 7/21 (33%)
zf-H2C2_2 268..293 CDD:290200 9/26 (35%)
C2H2 Zn finger 284..304 CDD:275368 8/21 (38%)
zf-H2C2_2 296..321 CDD:290200 5/24 (21%)
zf-C2H2_2 312..>387 CDD:289522 16/78 (21%)
C2H2 Zn finger 312..332 CDD:275368 0/19 (0%)
C2H2 Zn finger 340..360 CDD:275368 7/22 (32%)
C2H2 Zn finger 369..389 CDD:275368 6/20 (30%)
C2H2 Zn finger 397..417 CDD:275368 4/19 (21%)
zf-H2C2_2 409..434 CDD:290200 5/24 (21%)
C2H2 Zn finger 425..445 CDD:275368 5/21 (24%)
zf-H2C2_2 437..462 CDD:290200 8/26 (31%)
C2H2 Zn finger 453..473 CDD:275368 7/19 (37%)
zf-H2C2_2 465..490 CDD:290200 9/34 (26%)
C2H2 Zn finger 481..501 CDD:275368 9/21 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.