DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9609 and Zfp532

DIOPT Version :9

Sequence 1:NP_573161.1 Gene:CG9609 / 32663 FlyBaseID:FBgn0030787 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001347980.1 Gene:Zfp532 / 328977 MGIID:3036282 Length:1304 Species:Mus musculus


Alignment Length:448 Identity:98/448 - (21%)
Similarity:155/448 - (34%) Gaps:144/448 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 YACSMPKCEATFKRLDQLDRHEY-HHTGIK------KHACSYEGCDKTYSIVTHLKRHLRSTHER 92
            |.|  |.|...||.......|.| .|.|:|      .:.||.  ||..:::.|.|.||.   .:.
Mouse   867 YKC--PICPMAFKSAPSTHSHAYTQHPGVKIGEPKIIYKCSM--CDTVFTLQTLLYRHF---DQH 924

  Fly    93 PESAAKKTVKCALEECSKMFISVSNMTRHMRETH------ESP---------KVYPCSQCSAKFS 142
            .::......||  .:||.::.....|..|::..|      |.|         .|.|.:|.||..|
Mouse   925 TDNQKVSVFKC--PDCSLLYAQKQLMMDHIKSMHGTLKSIEGPPNLGINLPLSVKPATQNSANHS 987

  Fly   143 ----------QKLKLKRHEIREHTLE------YPYSCSKCSRGF-----YQQWQCQSHEPSCKLY 186
                      :||:.|.....:.:.|      ..::|.:|.|.|     |.....:.|....|.:
Mouse   988 REDAKSVNGKEKLEKKSPSPAKKSTEPKKMASLGWTCWECDRLFTQRDVYLSHMRKEHGKQMKKH 1052

  Fly   187 ECPGCPLQFDKWTLYTKH--CRDSLHGKNRHK-------CDRC-DS--AFDKPSELKRHLEVKH- 238
            .|..|...|.     :.|  ||   |.:.:||       |..| ||  .|.|...|:||:::.| 
Mouse  1053 PCRQCDKSFS-----SSHSLCR---HNRIKHKGIRKVYACSHCPDSRRTFTKRLMLERHIQLMHG 1109

  Fly   239 ---KEAAQTDECATSFTCNEEG------------------------------------------- 257
               .:..:..:.|...|.:||.                                           
Mouse  1110 IKDPDVKELSDDAGDVTNDEEEEAEIKEDAKVPSPKRKLEEPVLEFRPPRGAITQPLKKLKINVF 1174

  Fly   258 -------CGKSYSYLRNLRQHMLTAHS-GRRFECQALDCGRCFSSAQNLARHLLRDHK------- 307
                   ||.:...|....:|:....| |...:|:  :||.|::|..:|||||...||       
Mouse  1175 KVHKCAVCGFTTENLLQFHEHIPQHRSDGSSHQCR--ECGLCYTSHGSLARHLFIVHKLKEPQPV 1237

  Fly   308 ---DGA---TKKELKAKKKDKSKTGEGG--KTKSTSRKRRRDAGRSKHSRLSKLACLQ 357
               :||   :::|.|...:|::..|...  |.|..::....:|..:.|.|...:|.::
Mouse  1238 SKQNGAGEDSQQENKPSPEDEAAEGAASDRKCKVCAKTFETEAALNTHMRTHGMAFIK 1295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9609NP_573161.1 C2H2 Zn finger 40..59 CDD:275368 6/19 (32%)
zf-C2H2_8 67..150 CDD:292531 26/107 (24%)
C2H2 Zn finger 67..90 CDD:275368 8/22 (36%)
C2H2 Zn finger 106..126 CDD:275368 4/19 (21%)
C2H2 Zn finger 134..155 CDD:275368 7/30 (23%)
C2H2 Zn finger 188..210 CDD:275368 6/23 (26%)
C2H2 Zn finger 217..237 CDD:275368 9/22 (41%)
C2H2 Zn finger 253..276 CDD:275368 6/72 (8%)
C2H2 Zn finger 283..302 CDD:275368 8/18 (44%)
Zfp532NP_001347980.1 BASP1 150..360 CDD:330577
C2H2 Zn finger 753..772 CDD:275368
C2H2 Zn finger 782..802 CDD:275368
C2H2 Zn finger 810..832 CDD:275368
C2H2 Zn finger 841..858 CDD:275368
C2H2 Zn finger 869..890 CDD:275368 7/22 (32%)
C2H2 Zn finger 904..924 CDD:275368 8/24 (33%)
C2H2 Zn finger 1024..1044 CDD:275368 5/19 (26%)
C2H2 Zn finger 1054..1075 CDD:275368 7/28 (25%)
C2H2 Zn finger 1084..1104 CDD:275368 8/19 (42%)
C2H2 Zn finger 1179..1199 CDD:275368 4/19 (21%)
zf-C2H2_11 1202..1230 CDD:318763 11/29 (38%)
C2H2 Zn finger 1208..1229 CDD:275368 10/22 (45%)
C2H2 Zn finger 1269..1289 CDD:275368 4/19 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836467
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.