DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9609 and Opbp

DIOPT Version :9

Sequence 1:NP_573161.1 Gene:CG9609 / 32663 FlyBaseID:FBgn0030787 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_724479.1 Gene:Opbp / 246618 FlyBaseID:FBgn0050443 Length:562 Species:Drosophila melanogaster


Alignment Length:275 Identity:73/275 - (26%)
Similarity:105/275 - (38%) Gaps:56/275 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 CEATFKRLDQ--LDRH-EYHHTGIKKHACSYEGCDKTYSIVTHLKRHLRSTHERP---ESAAKKT 100
            ||...|..|:  |..| :.|.....:..||.  |::.:......:.| :..||:|   ||:.|..
  Fly   226 CEICNKSFDETLLTVHKQMHQQESSEIMCSI--CNRKFENEVTYQMH-QKIHEKPRDSESSRKLA 287

  Fly   101 VKCALEE---------CSKMFISVSNMTRHMRETHESPKVYPCSQCSAKFSQKLKLKRHEIREHT 156
            .:.:|::         |.::|.......:|.| .|...|.|.|..|...|.....|..| :|.||
  Fly   288 QRTSLDKEKPGFPCQYCERVFTRPFEKVKHER-VHTGEKPYACEVCGKTFRVSYSLTLH-LRTHT 350

  Fly   157 LEYPYSCSKCSRGFYQQWQCQSH----EPSCKLYECPGCPLQFDKWTLYTKHCRDSLHGKNRH-- 215
            ...||.|:.|::.| :..|..||    ..|.:.:.|..||..|........|       ||.|  
  Fly   351 NIRPYVCTVCNKRF-KSHQVYSHHLRIHSSERQFSCDACPKTFRTSVQLYAH-------KNTHTK 407

  Fly   216 --KCDRCDSAFDKPSELKRHLEVKHKE-----------------AAQTDECATSFTCNEEGCGKS 261
              :|..|:..|.....:|.|::. |||                 |....:.|..|.||.  ||..
  Fly   408 PYRCAVCNRPFSSMYAVKNHMQT-HKEISSKGSVGSGTPNIKSAATSKSQAAGKFYCNT--CGAE 469

  Fly   262 YSYLRNLRQHMLTAH 276
            |:.|..||.||.:||
  Fly   470 YARLFALRLHMKSAH 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9609NP_573161.1 C2H2 Zn finger 40..59 CDD:275368 6/19 (32%)
zf-C2H2_8 67..150 CDD:292531 22/94 (23%)
C2H2 Zn finger 67..90 CDD:275368 4/22 (18%)
C2H2 Zn finger 106..126 CDD:275368 4/28 (14%)
C2H2 Zn finger 134..155 CDD:275368 6/20 (30%)
C2H2 Zn finger 188..210 CDD:275368 5/21 (24%)
C2H2 Zn finger 217..237 CDD:275368 5/19 (26%)
C2H2 Zn finger 253..276 CDD:275368 10/22 (45%)
C2H2 Zn finger 283..302 CDD:275368
OpbpNP_724479.1 C2H2 Zn finger 254..274 CDD:275368 4/22 (18%)
C2H2 Zn finger 301..321 CDD:275368 4/20 (20%)
zf-H2C2_2 316..336 CDD:290200 7/20 (35%)
C2H2 Zn finger 329..349 CDD:275368 6/20 (30%)
zf-H2C2_2 341..366 CDD:290200 10/26 (38%)
C2H2 Zn finger 357..377 CDD:275368 6/20 (30%)
C2H2 Zn finger 385..405 CDD:275368 7/26 (27%)
C2H2 Zn finger 411..431 CDD:275368 5/20 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.