DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9609 and Y48A6B.8

DIOPT Version :9

Sequence 1:NP_573161.1 Gene:CG9609 / 32663 FlyBaseID:FBgn0030787 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_499419.1 Gene:Y48A6B.8 / 190012 WormBaseID:WBGene00012969 Length:551 Species:Caenorhabditis elegans


Alignment Length:431 Identity:80/431 - (18%)
Similarity:128/431 - (29%) Gaps:159/431 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 TALEEFKQRQGRRNSIGSAKYACSMPKCEATFKRLDQLDRHEYHHTGIKKHACSYEGCDKTYSIV 79
            ||..:.|.|:|          .|.....|||.   |..||               ......:.:.
 Worm   174 TAYRKQKLREG----------TCCSQSNEATG---DSTDR---------------SSTSAGFDVF 210

  Fly    80 THLK-RHLRSTH-ERPESAAK--------KTVKCALEECSKMFISVSNMTRH------------- 121
            .||: |.::.|. |:.|||.:        ..||..||..:...|.:....:|             
 Worm   211 QHLQNRAVQKTMIEQLESAVRNQDVMEMGNVVKKGLENGTLSEIQIEEFCKHTTRPNFSILQFVQ 275

  Fly   122 -MRETHESPK------------------------VYPCSQCSAKFSQKLK----LKRHEIREHTL 157
             :|::.|..|                        .......::|.|::|.    :||.....||:
 Worm   276 ALRQSTEDEKESIQIAQMMMFKMQDPKDGNYTALAANVHTLTSKISKQLNAGCIVKRTLTMNHTI 340

  Fly   158 EYPYSCSKCS-------------------RGFYQQWQCQSHEPSCKLYEC---PGCPLQFDKWTL 200
            ........|:                   ..||........|||.|::..   |.|..:.|    
 Worm   341 SQADGFPTCNLTDIYNSELLIGGDAVSQLSNFYMVALKTMLEPSYKIWAFTYRPSCVRRVD---- 401

  Fly   201 YTKHCRDSLHGKNRHKCDRCDSAFD-----KPSEL------KRH-----------LEVKHKEAAQ 243
              :|.::.   ..:......:.|||     .|.||      :.|           |||:.:.   
 Worm   402 --RHFQEL---PQKVTTAIIEVAFDIVGVYLPVELSYGSIDREHEFIKTLGEGAELEVQRRR--- 458

  Fly   244 TDECATSFTCNEEGCGKSYSYLRNLRQHMLTAHSGRRFECQALDCGRCFSSAQNLARHL----LR 304
             ||..|.|....|..||:   :.|||.:......|..|.|         :.......||    :|
 Worm   459 -DERITVFKNAVEALGKA---MNNLRTYHFDIAKGALFNC---------NKPSYCEHHLKWGQVR 510

  Fly   305 DHKDGATKKELKAKKKDKSKTGEGGKTKSTSRKRRRDAGRS 345
            ..::...:.|...::..:..||:..:...::      ||||
 Worm   511 KFREQHQRMETSPEEVIRFATGQRNEHDVSA------AGRS 545

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9609NP_573161.1 C2H2 Zn finger 40..59 CDD:275368 6/18 (33%)
zf-C2H2_8 67..150 CDD:292531 21/134 (16%)
C2H2 Zn finger 67..90 CDD:275368 3/23 (13%)
C2H2 Zn finger 106..126 CDD:275368 4/33 (12%)
C2H2 Zn finger 134..155 CDD:275368 5/24 (21%)
C2H2 Zn finger 188..210 CDD:275368 4/24 (17%)
C2H2 Zn finger 217..237 CDD:275368 9/41 (22%)
C2H2 Zn finger 253..276 CDD:275368 6/22 (27%)
C2H2 Zn finger 283..302 CDD:275368 1/18 (6%)
Y48A6B.8NP_499419.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160168009
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.