DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9609 and unc-98

DIOPT Version :9

Sequence 1:NP_573161.1 Gene:CG9609 / 32663 FlyBaseID:FBgn0030787 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_509284.2 Gene:unc-98 / 181020 WormBaseID:WBGene00006827 Length:310 Species:Caenorhabditis elegans


Alignment Length:168 Identity:48/168 - (28%)
Similarity:65/168 - (38%) Gaps:25/168 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 YPCSQCSAKFSQKLKLKRHEIREHTLEYPYSCSKCSRGFYQQWQCQSHEPSCKLYECPG----CP 192
            |.|..|...|:....|:.|| |.|.:..||.|.||...|  ::.||....:.:..|..|    |.
 Worm   113 YKCRFCGLTFNFMNTLRAHE-RIHDVSQPYVCGKCGDSF--EFACQLEYHAAQHSEIDGYKCECG 174

  Fly   193 LQFDKWT--LYTKHCRDSLH------------GKNRHKCDRCDSAFDKPSELKRHLEVKHKEAAQ 243
            ..|..:|  ||.||..|.|.            .|.| .....:....:|:.:....|.||.....
 Worm   175 RTFFSYTEMLYHKHTDDPLELIGAPETTTIKVSKKR-VLPVSEQDLPQPAFVTEGYEPKHPLRVY 238

  Fly   244 TDECATSFTCNEEGCGKSYSYLRNLRQHMLTAHSGRRF 281
            .|..:..:.|  |.|.||||..|.|..||. :|.|.::
 Worm   239 NDVRSKPYIC--EYCSKSYSDSRGLAYHMY-SHRGEKY 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9609NP_573161.1 C2H2 Zn finger 40..59 CDD:275368
zf-C2H2_8 67..150 CDD:292531 5/17 (29%)
C2H2 Zn finger 67..90 CDD:275368
C2H2 Zn finger 106..126 CDD:275368
C2H2 Zn finger 134..155 CDD:275368 7/20 (35%)
C2H2 Zn finger 188..210 CDD:275368 9/27 (33%)
C2H2 Zn finger 217..237 CDD:275368 2/19 (11%)
C2H2 Zn finger 253..276 CDD:275368 11/22 (50%)
C2H2 Zn finger 283..302 CDD:275368
unc-98NP_509284.2 C2H2 Zn finger 115..135 CDD:275368 7/20 (35%)
C2H2 Zn finger 143..163 CDD:275368 6/21 (29%)
SFP1 <169..268 CDD:227516 27/102 (26%)
C2H2 Zn finger 171..189 CDD:275368 6/17 (35%)
C2H2 Zn finger 248..268 CDD:275368 11/22 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.