DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9609 and ztf-15

DIOPT Version :9

Sequence 1:NP_573161.1 Gene:CG9609 / 32663 FlyBaseID:FBgn0030787 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_492052.2 Gene:ztf-15 / 172470 WormBaseID:WBGene00011066 Length:729 Species:Caenorhabditis elegans


Alignment Length:391 Identity:70/391 - (17%)
Similarity:136/391 - (34%) Gaps:108/391 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 META--LEEFKQRQGRRNSIGSAKYACSMPKCEATF----KRLDQL---------DRHEYHHTGI 62
            :||.  ::|||.....|....|..:...|.||.::.    ..|||.         .::||.....
 Worm   328 LETTDEIQEFKCNVCYRRYNSSFWFERHMEKCNSSTALPPALLDQTISCPNCHKKYQNEYWFDYH 392

  Fly    63 KKHACSYEGCDKTYSIVTHLKRHLRSTHER-------------------PE-------------- 94
            |||      |......::.:...:.|..:|                   ||              
 Worm   393 KKH------CPDITPALSDVHLDVNSLRDRRPREGEISVVPDVNLFGIEPEREDDNDDDEDADAT 451

  Fly    95 --SAAKKT-----VKCALEECSKMFISVSNMTRHMRETHESPKVYPCSQCSAKFSQKLKLKRHEI 152
              |::..|     :.|::  |.|..:.|:::..|.::.|....:..|..|:.||:....::||..
 Worm   452 ISSSSSSTGNLVNIPCSI--CGKFCVGVASLLHHRKQIHGLTAMLTCGVCTKKFNTLSSIRRHMS 514

  Fly   153 REHTLEYPYSCSKCSRGFYQQWQCQSHE---------------PSCKLYECPGCPLQFDKWTLYT 202
            .|:::   :.|.:|.|....:.....||               .:..:.:||.|...|....:.:
 Worm   515 MEYSI---FRCQQCGRNCIDRTTLDRHECFKPYKIRDKRLFNIQNISVLKCPDCRATFANLNVLS 576

  Fly   203 KHCRDSLHG--------------KNRHKCDRCDSAFDKPSELKRHLEVKHKEAAQTDECATSFTC 253
            :|.:...:|              :..|:.|...:|      |:|.:..:.:..:.|.|   .:||
 Worm   577 EHRKTCQYGNVFDNIQQPGSSSLRQHHRSDTNGAA------LQRKITSRVRLDSNTPE---KWTC 632

  Fly   254 NEEGCGKSYSYLRNLRQHMLTAHSGRRFECQALDCGRCFSSAQNLARHLLRDHKDGATKKELKAK 318
            .:  |..|:..|:.|..|...:|....|:|.  :|.....:.:.|..|.:...::..:..|...:
 Worm   633 RD--CHASFHNLQALCSHRHESHGKEMFQCN--NCSETLPNYRALHDHNMMHCRNNRSTNETTTR 693

  Fly   319 K 319
            :
 Worm   694 R 694

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9609NP_573161.1 C2H2 Zn finger 40..59 CDD:275368 7/31 (23%)
zf-C2H2_8 67..150 CDD:292531 17/122 (14%)
C2H2 Zn finger 67..90 CDD:275368 2/22 (9%)
C2H2 Zn finger 106..126 CDD:275368 4/19 (21%)
C2H2 Zn finger 134..155 CDD:275368 6/20 (30%)
C2H2 Zn finger 188..210 CDD:275368 5/21 (24%)
C2H2 Zn finger 217..237 CDD:275368 4/19 (21%)
C2H2 Zn finger 253..276 CDD:275368 6/22 (27%)
C2H2 Zn finger 283..302 CDD:275368 3/18 (17%)
ztf-15NP_492052.2 C2H2 Zn finger 178..199 CDD:275368
C2H2 Zn finger 207..223 CDD:275368
C2H2 Zn finger 233..250 CDD:275368
SFP1 <337..395 CDD:227516 13/57 (23%)
C2H2 Zn finger 467..488 CDD:275368 5/22 (23%)
C2H2 Zn finger 496..514 CDD:275368 6/17 (35%)
C2H2 Zn finger 522..538 CDD:275368 3/15 (20%)
C2H2 Zn finger 562..581 CDD:275368 5/18 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.