DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9609 and szy-5

DIOPT Version :9

Sequence 1:NP_573161.1 Gene:CG9609 / 32663 FlyBaseID:FBgn0030787 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_491745.2 Gene:szy-5 / 172281 WormBaseID:WBGene00016154 Length:603 Species:Caenorhabditis elegans


Alignment Length:212 Identity:56/212 - (26%)
Similarity:80/212 - (37%) Gaps:52/212 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 CSYEGCDKTYSIVTHLKRHLRSTHERPESAAKKTVKCALEECSKMFISVSNMTRHMRE-THESPK 130
            |.|...|.|       .|..| ..:||.:.....|     :|:|.....|.:|.|:|: |.|.|.
 Worm    48 CLYRRNDPT-------NRSYR-MKKRPPAQIYHCV-----QCNKHIKYPSKITEHIRKHTGEKPN 99

  Fly   131 VYPCSQCSAKFSQKLKLKRHEIREHTLEYPYSCSKCSRGFYQQWQCQSHEPSCKLYECPGCPLQF 195
            |  ||.|:..|||...||.| :::|..|.||.||.|:..|...::...||               
 Worm   100 V--CSICNISFSQAHTLKTH-MQQHAHEKPYKCSFCTAEFLNVYEKNEHE--------------- 146

  Fly   196 DKWTLYTKHCRDSLHGKNRHKCDRCDSAFDKPSELKRHLEVKHKEAAQTDECATSFTCNEEGCG- 259
                  .:|.....||:...:.:...|.|.:.:|     .....|..|..||:       |.|| 
 Worm   147 ------EQHMHHPNHGETMEENNATTSQFIQVAE-----PTIQAEPCQIYECS-------EMCGF 193

  Fly   260 KSYSYLRNLRQHMLTAH 276
            :||.. ..:.:||...|
 Worm   194 QSYEE-AEVVEHMTVTH 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9609NP_573161.1 C2H2 Zn finger 40..59 CDD:275368
zf-C2H2_8 67..150 CDD:292531 27/83 (33%)
C2H2 Zn finger 67..90 CDD:275368 6/22 (27%)
C2H2 Zn finger 106..126 CDD:275368 6/20 (30%)
C2H2 Zn finger 134..155 CDD:275368 9/20 (45%)
C2H2 Zn finger 188..210 CDD:275368 1/21 (5%)
C2H2 Zn finger 217..237 CDD:275368 3/19 (16%)
C2H2 Zn finger 253..276 CDD:275368 7/23 (30%)
C2H2 Zn finger 283..302 CDD:275368
szy-5NP_491745.2 C2H2 Zn finger 73..93 CDD:275368 7/24 (29%)
C2H2 Zn finger 101..121 CDD:275368 9/20 (45%)
C2H2 Zn finger 129..149 CDD:275368 6/40 (15%)
C2H2 Zn finger 431..451 CDD:275368
zf-H2C2_2 445..468 CDD:372612
C2H2 Zn finger 459..479 CDD:275368
C2H2 Zn finger 487..506 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104508
Panther 1 1.100 - - O PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.