DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RAB37 and ypt5

DIOPT Version :9

Sequence 1:NP_001157461.1 Gene:RAB37 / 326624 HGNCID:30268 Length:228 Species:Homo sapiens
Sequence 2:NP_001342856.1 Gene:ypt5 / 2542248 PomBaseID:SPAC6F6.15 Length:211 Species:Schizosaccharomyces pombe


Alignment Length:165 Identity:68/165 - (41%)
Similarity:100/165 - (60%) Gaps:3/165 - (1%)


- Green bases have known domain annotations that are detailed below.


Human    34 NSKVMLLGDTGVGKTCFLIQFKDGAFLSGTFIATVGIDFRNKVVTVD-GVRVKLQIWDTAGQERF 97
            |.|::||||:.|||:..:::|....| .....:|:|..|..:.:.:| ...|||:|||||||||:
pombe    14 NQKLVLLGDSAVGKSSLVLRFVKDQF-DDYRESTIGAAFLTQTLPIDENTSVKLEIWDTAGQERY 77

Human    98 RSVTHAYYRDAQALLLLYDITNKSSFDNIRAWLTEIHEYAQRDVVIMLLGNKADMSSE-RVIRSE 161
            :|:...|||:|...:::||||..:|.:..::|:.|:...|...:||.|.|||.|::.| |.:...
pombe    78 KSLAPMYYRNANCAIVVYDITQAASLEKAKSWIKELQRQAPEGIVIALAGNKLDLAQERRAVEKA 142

Human   162 DGETLAREYGVPFLETSAKTGMNVELAFLAIAKEL 196
            |.|..|.|..:.|.||||||..||...|.||||:|
pombe   143 DAEAYAAEANLLFFETSAKTAENVNELFTAIAKKL 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RAB37NP_001157461.1 Rab26 36..225 CDD:206695 67/163 (41%)
RAB 36..197 CDD:197555 67/163 (41%)
ypt5NP_001342856.1 Rab5_related 16..178 CDD:206653 67/163 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.