DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL22 and MRPL22

DIOPT Version :9

Sequence 1:NP_523379.2 Gene:mRpL22 / 32662 FlyBaseID:FBgn0030786 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_014222.2 Gene:MRPL22 / 855544 SGDID:S000005121 Length:309 Species:Saccharomyces cerevisiae


Alignment Length:131 Identity:34/131 - (25%)
Similarity:58/131 - (44%) Gaps:14/131 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 IKYSPDKMWYIAAFVRGMSVDEALKQLNFVLKKGATDVKET----ILEAQQIAVERHNVEYKSNL 159
            ||.|..|...:...:.|:.|.:|:.|.:|..||.|.:|.|.    :.:.|::.::..:: |.|.:
Yeast   170 IKSSMKKATLLLRLLGGLDVMKAISQCHFSNKKIAREVAELLQKGVKDGQKLGLKPEDL-YISQI 233

  Fly   160 WIAESFVGKGRV-FKGVRRHARGRFGKVE--YKHCHYFVRLEEGEPPQHYYQEPQTPEQQYESWM 221
            |.......:.|| ||     ||.|.|.:.  |.|....:|.:.....:..| |....||:...|:
Yeast   234 WTGSDGFWRKRVEFK-----ARTRIGIISHPYIHVRCILRTKSVTKRRLAY-EAHLKEQKRAPWV 292

  Fly   222 E 222
            :
Yeast   293 Q 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL22NP_523379.2 Ribosomal_L22 95..197 CDD:278658 28/104 (27%)
MRPL22NP_014222.2 Ribosomal_L22 165..268 CDD:395181 28/103 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343968
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0091
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002565
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101227
Panther 1 1.100 - - LDO PTHR13501
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4450
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.