DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL22 and rpl22

DIOPT Version :9

Sequence 1:NP_523379.2 Gene:mRpL22 / 32662 FlyBaseID:FBgn0030786 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_051097.1 Gene:rpl22 / 844721 -ID:- Length:160 Species:Arabidopsis thaliana


Alignment Length:128 Identity:35/128 - (27%)
Similarity:60/128 - (46%) Gaps:14/128 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 IKYSPDKMWYIAAFVRGMSVDEALKQLNFVLKKGATDVKETILEAQQIAVERHNVEYK-SNLWIA 162
            |..|..|...:...:||.|.:|||..|..:..:|...:.:.:..|  .|...||..:| :||.|:
plant    20 ISMSAHKARRVIDQIRGRSYEEALMILELMPYRGCYPIFKLVYSA--AANASHNKGFKETNLVIS 82

  Fly   163 ESFVGKGRVFKGVRRHARGRFGKVEYKHCHYFVRLEEGEPPQHYYQEPQTPEQQYESWMEQMR 225
            ::.|.:|...|.::..||||...::...||..:.||:    ..:|       ||||.::..::
plant    83 KAEVNQGNTVKKLKPRARGRSYPIKRSTCHITIVLED----ISFY-------QQYEEYLMYLK 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL22NP_523379.2 Ribosomal_L22 95..197 CDD:278658 28/98 (29%)
rpl22NP_051097.1 rpl22 4..120 CDD:214342 30/105 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002565
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101227
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.