DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL22 and AT1G67430

DIOPT Version :10

Sequence 1:NP_523379.2 Gene:mRpL22 / 32662 FlyBaseID:FBgn0030786 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_176910.1 Gene:AT1G67430 / 843063 AraportID:AT1G67430 Length:175 Species:Arabidopsis thaliana


Alignment Length:152 Identity:30/152 - (19%)
Similarity:53/152 - (34%) Gaps:62/152 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 NKYNYGPRKWLEYNKTVHPPQETDEEPRNAYVCHMRSNIKYSPDKMWYIAAFVRGMSVDEALKQL 125
            |:::.|..:|         |.::.:     :|..:..|.:.:        |.|:|:.|| ||   
plant    75 NRHSNGQGRW---------PAKSAQ-----FVLDLLKNAESN--------AEVKGLDVD-AL--- 113

  Fly   126 NFVLKKGATDVKETILEAQQIAVERHNVEYKSNLWIAESFVGKGRVFKGVRRHARGRFGKVEYKH 190
             |:          :.::..|.|.:|.                  |.::     |.||........
plant   114 -FI----------SHIQVNQAAKQRR------------------RTYR-----AHGRINPYMSNP 144

  Fly   191 CHYFVRLEEGEPPQHYYQEPQT 212
            ||..:.|.|.|.|  ..:||:|
plant   145 CHIELILSEKEEP--VKKEPET 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL22NP_523379.2 Ribosomal_L22 94..198 CDD:459725 18/103 (17%)
AT1G67430NP_176910.1 PTZ00178 1..175 CDD:240306 30/152 (20%)

Return to query results.
Submit another query.