DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL22 and AT1G52370

DIOPT Version :9

Sequence 1:NP_523379.2 Gene:mRpL22 / 32662 FlyBaseID:FBgn0030786 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_001031174.1 Gene:AT1G52370 / 841667 AraportID:AT1G52370 Length:269 Species:Arabidopsis thaliana


Alignment Length:267 Identity:73/267 - (27%)
Similarity:103/267 - (38%) Gaps:83/267 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VIRQM---------------SQLRLQAP--QG--AALLRSADSS----------SIS-------- 31
            ||||:               |...|::|  ||  .:||||..||          .||        
plant    11 VIRQVGKRVKDSHISTANYSSTRNLESPFSQGYLQSLLRSTYSSRPLYYHLQQLGISTSRQLQAG 75

  Fly    32 --PAISPVSPPALQSKSLHTAASAGMLCAKWNKYNYGPRKWLEYNKTVHPPQETDEEPRNAYVCH 94
              |..||:|.|||......                       |..|.:         |:...|..
plant    76 EEPVSSPLSSPALLGSGKE-----------------------EEQKII---------PKRQKVQA 108

  Fly    95 MRSNIKYSPDKMWYIAAFVRGMSVDEALKQLNFVLKKGATDVKETILEAQQIAVERHNVEYKSNL 159
            :..:||.||.|:..:||.||||.|::||.||...:|:.:..|...|..|:..|...|.:: ...|
plant   109 VLKSIKQSPKKVNLVAALVRGMRVEDALMQLQVTVKRASQTVYRVIHAARANATHNHGLD-PDRL 172

  Fly   160 WIAESFVGKGRVFKGVRRHARGRFGKVEYKHCHYFVRLEEGEPPQHYYQEPQTPEQQYESWMEQM 224
            .:||:|||||...|.|..||:||.|.:....|...|.:.|           .|.|::.|....::
plant   173 LVAEAFVGKGLFGKKVAYHAKGRSGIISIPRCRLTVIVRE-----------TTAEEEAEIARLKV 226

  Fly   225 RSRKIIN 231
            .:.|.:|
plant   227 HNFKKLN 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL22NP_523379.2 Ribosomal_L22 95..197 CDD:278658 39/101 (39%)
AT1G52370NP_001031174.1 Ribosomal_L22 108..210 CDD:278658 39/102 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 67 1.000 Domainoid score I3514
eggNOG 1 0.900 - - E1_COG0091
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002565
OrthoInspector 1 1.000 - - otm3047
orthoMCL 1 0.900 - - OOG6_101227
Panther 1 1.100 - - LDO PTHR13501
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.770

Return to query results.
Submit another query.