DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL22 and AT4G28360

DIOPT Version :9

Sequence 1:NP_523379.2 Gene:mRpL22 / 32662 FlyBaseID:FBgn0030786 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_567805.1 Gene:AT4G28360 / 828951 AraportID:AT4G28360 Length:271 Species:Arabidopsis thaliana


Alignment Length:265 Identity:71/265 - (26%)
Similarity:101/265 - (38%) Gaps:82/265 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHKVIRQM----------------SQLRLQAP--QG--AALLRSADSS----------------- 28
            :..||||:                |...|::|  ||  .:|||.:.||                 
plant     8 LQTVIRQVGRRVKNSHISTANYSSSTRNLESPFSQGYLQSLLRPSYSSRPLYHHLQQLGISTSRQ 72

  Fly    29 ---SISPAISPVSPPALQSKSLHTAASAGMLCAKWNKYNYGPRKWLEYNKTVHPPQETDEEPRNA 90
               |..|..||:|.|||......                       |..|.:         |:..
plant    73 LQASEEPVSSPLSSPALLGSGKE-----------------------EEQKII---------PKRQ 105

  Fly    91 YVCHMRSNIKYSPDKMWYIAAFVRGMSVDEALKQLNFVLKKGATDVKETILEAQQIAVERHNVEY 155
            .|..:..:||.||.|:..:||.||||.|::||.||...:|:.|..|...|..|:..|...|.:: 
plant   106 KVQAVLKSIKQSPKKVNLVAALVRGMRVEDALIQLQVTVKRAAQTVYRVIHAARANATHNHGLD- 169

  Fly   156 KSNLWIAESFVGKGRVFKGVRRHARGRFGKVEYKHCHYFVRLEEGEPPQ---------HYYQEPQ 211
            ...|.:||:|||||...|.|..||:||.|.:....|...|.:.|..|.:         |.:::..
plant   170 PDRLLVAEAFVGKGLFGKKVAYHAKGRSGIISIPRCRLTVIVRETTPEEEAEIARLKVHNFKKKS 234

  Fly   212 TPEQQ 216
            ..|:|
plant   235 KRERQ 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL22NP_523379.2 Ribosomal_L22 95..197 CDD:278658 40/101 (40%)
AT4G28360NP_567805.1 Ribosomal_L22 109..212 CDD:395181 40/103 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 67 1.000 Domainoid score I3514
eggNOG 1 0.900 - - E1_COG0091
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002565
OrthoInspector 1 1.000 - - otm3047
orthoMCL 1 0.900 - - OOG6_101227
Panther 1 1.100 - - O PTHR13501
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.770

Return to query results.
Submit another query.