DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL22 and rpl17

DIOPT Version :9

Sequence 1:NP_523379.2 Gene:mRpL22 / 32662 FlyBaseID:FBgn0030786 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_001005078.1 Gene:rpl17 / 448653 XenbaseID:XB-GENE-5859417 Length:184 Species:Xenopus tropicalis


Alignment Length:174 Identity:36/174 - (20%)
Similarity:53/174 - (30%) Gaps:61/174 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 EEPRNAYVCHMR-SNIKYSPDKMWYIAAFVRGMSVDEALKQLNFVLKKGATDVKETILEAQQIAV 148
            |.|..:  |..| ||::.........|..::||.:.:|.|.|           |:..|:.|.:..
 Frog     9 ENPTKS--CKARGSNLRVHFKNTRETAQAIKGMHIRKATKYL-----------KDVTLKKQCVPF 60

  Fly   149 ERHN------VEYKSNLWIAESFVGKGRVF--------------KGV------------------ 175
            .|:|      .:.|...|....:..|...|              ||:                  
 Frog    61 RRYNGGVGRCAQAKQWDWTQGRWPKKSANFLLHILKNAESNAEVKGLDVDSLVIEHIQVNKAPKM 125

  Fly   176 -RR--HARGRFGKVEYKHCHYFVRLEEGEPPQHYYQEPQTPEQQ 216
             ||  .|.||........||..:.|.|.|      |....||::
 Frog   126 RRRTYRAHGRINPYMSSPCHIELILTEKE------QIVPKPEEE 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL22NP_523379.2 Ribosomal_L22 95..197 CDD:278658 27/143 (19%)
rpl17NP_001005078.1 PTZ00178 1..165 CDD:240306 36/174 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.