DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL22 and MRPL22

DIOPT Version :9

Sequence 1:NP_523379.2 Gene:mRpL22 / 32662 FlyBaseID:FBgn0030786 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_054899.2 Gene:MRPL22 / 29093 HGNCID:14480 Length:206 Species:Homo sapiens


Alignment Length:192 Identity:91/192 - (47%)
Similarity:123/192 - (64%) Gaps:13/192 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 LQSKSLHTAASAGMLCAKWNKYNYGPRKWLEYNKTVHPPQETDEEPRNAYVCHMRSNIKYSPDKM 106
            |....:||:||..:           .|||.:.||.|:|||...|..|.|.:.|.|..||||.|||
Human    28 LPQSYIHTSASLDI-----------SRKWEKKNKIVYPPQLPGEPRRPAEIYHCRRQIKYSKDKM 81

  Fly   107 WYIAAFVRGMSVDEALKQLNFVLKKGATDVKETILEAQQIAVERHNVEYKSNLWIAESFVGKGRV 171
            ||:|..:||||:|:||.||.|..||||..:||.:||||.:||..||||::|||:||||..|:|:.
Human    82 WYLAKLIRGMSIDQALAQLEFNDKKGAKIIKEVLLEAQDMAVRDHNVEFRSNLYIAESTSGRGQC 146

  Fly   172 FKGVRRHARGRFGKVEYKHCHYFVRLEEGEPPQHYYQEPQTPEQQYESWMEQMRSRKIINSL 233
            .|.:|.|.|||||.:|..:|||||:|.||.||..  :.|:|.....:.:::|:|||.|:::|
Human   147 LKRIRYHGRGRFGIMEKVYCHYFVKLVEGPPPPP--EPPKTAVAHAKEYIQQLRSRTIVHTL 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL22NP_523379.2 Ribosomal_L22 95..197 CDD:278658 60/101 (59%)
MRPL22NP_054899.2 Ribosomal_L22 69..172 CDD:395181 61/102 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147702
Domainoid 1 1.000 129 1.000 Domainoid score I5269
eggNOG 1 0.900 - - E1_COG0091
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H56664
Inparanoid 1 1.050 174 1.000 Inparanoid score I4074
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45261
OrthoDB 1 1.010 - - D1054896at2759
OrthoFinder 1 1.000 - - FOG0002565
OrthoInspector 1 1.000 - - oto88926
orthoMCL 1 0.900 - - OOG6_101227
Panther 1 1.100 - - LDO PTHR13501
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4450
SonicParanoid 1 1.000 - - X4362
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.