DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL22 and Mrpl22

DIOPT Version :9

Sequence 1:NP_523379.2 Gene:mRpL22 / 32662 FlyBaseID:FBgn0030786 Length:233 Species:Drosophila melanogaster
Sequence 2:XP_017169936.1 Gene:Mrpl22 / 216767 MGIID:1333794 Length:223 Species:Mus musculus


Alignment Length:221 Identity:99/221 - (44%)
Similarity:133/221 - (60%) Gaps:23/221 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 AALLRSADSSSI------SPAISPVSPPALQSKSLHTAASAGMLCAKWNKYNYGPRKWLEYNKTV 77
            |||||...:..:      :.....|.||:    .:||:||..:           .|||.:.||.|
Mouse    20 AALLRELGALRVPNLRIWATQTLRVLPPS----CIHTSASLDI-----------SRKWEKKNKIV 69

  Fly    78 HPPQETDEEPRNAYVCHMRSNIKYSPDKMWYIAAFVRGMSVDEALKQLNFVLKKGATDVKETILE 142
            :|||...|..|.|.:.|.|..||||.|||||:|..:||||:|:||.||.|..||||..:||.:||
Mouse    70 YPPQLPGEPRRPAEIYHCRRQIKYSKDKMWYLAKMIRGMSIDQALAQLEFNDKKGAQIIKEVLLE 134

  Fly   143 AQQIAVERHNVEYKSNLWIAESFVGKGRVFKGVRRHARGRFGKVEYKHCHYFVRLEEGEPPQHYY 207
            ||.:||..||||::|||.||||..|:|:..|.:|.|.|||||.:|..:|||||:|.||.||..  
Mouse   135 AQDMAVRDHNVEFRSNLHIAESTSGRGQCLKRIRYHGRGRFGIMEKVYCHYFVKLVEGPPPPP-- 197

  Fly   208 QEPQTPEQQYESWMEQMRSRKIINSL 233
            :.|:|.....:.:::|:|||.||::|
Mouse   198 EVPKTAVDHAKDYIQQLRSRTIIHTL 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL22NP_523379.2 Ribosomal_L22 95..197 CDD:278658 60/101 (59%)
Mrpl22XP_017169936.1 Ribosomal_L22 86..189 CDD:376305 61/102 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837782
Domainoid 1 1.000 128 1.000 Domainoid score I5344
eggNOG 1 0.900 - - E1_COG0091
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H56664
Inparanoid 1 1.050 172 1.000 Inparanoid score I4083
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45261
OrthoDB 1 1.010 - - D1054896at2759
OrthoFinder 1 1.000 - - FOG0002565
OrthoInspector 1 1.000 - - oto92493
orthoMCL 1 0.900 - - OOG6_101227
Panther 1 1.100 - - LDO PTHR13501
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4450
SonicParanoid 1 1.000 - - X4362
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1716.800

Return to query results.
Submit another query.