DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL22 and mrpl-22

DIOPT Version :9

Sequence 1:NP_523379.2 Gene:mRpL22 / 32662 FlyBaseID:FBgn0030786 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_499340.1 Gene:mrpl-22 / 176482 WormBaseID:WBGene00012645 Length:260 Species:Caenorhabditis elegans


Alignment Length:261 Identity:72/261 - (27%)
Similarity:116/261 - (44%) Gaps:40/261 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LRLQAPQGAALLRSADSS----SISPAI--------------SPVSPPALQSKSLHTAASAGMLC 57
            ||:....|:...|:..:|    |:.|.:              |.:..|.||..  ...:|.....
 Worm     2 LRVLVRTGSEACRAVSTSTAVLSVHPVVKSEDLSAKEIWDRRSKLRVPKLQKD--EQLSSKVYFA 64

  Fly    58 AKWN----------------KYNYGPRKWLEYNKTVHPPQETDEE---PRNAYVCHMRSNIKYSP 103
            .:|:                .|...|.||..|||.|.||.....|   |:...|.|.:.::.:||
 Worm    65 PEWDLEKKPNLDEGFVNPLKGYGMTPEKWEYYNKVVWPPNYIVPETGLPKPKEVFHCKESVHFSP 129

  Fly   104 DKMWYIAAFVRGMSVDEALKQLNFVLKKGATDVKETILEAQQIAVERHNVEYKSNLWIAESFVGK 168
            .:||.....|..|:||||:.||:....|....:.:||.:|:..|.:..::||.|.:::|::|..:
 Worm   130 KRMWAACQLVWKMNVDEAITQLDMQQLKACNLLMDTIKKAKSRAADEFHIEYPSQMYVADAFPVQ 194

  Fly   169 GRVFKGVRRHARGRFGKVEYKHCHYFVRLEEGEPPQHYYQEPQTPEQQY-ESWMEQMRSRKIINS 232
            ..:.||.||||...:..:.|::.|.|||||||..||...:.||.....: :.:...:|||.:..|
 Worm   195 SNIVKGARRHAHDNWNTIRYRYIHIFVRLEEGPAPQQKQRHPQKNGWDHMDEYYNYLRSRTVKYS 259

  Fly   233 L 233
            :
 Worm   260 I 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL22NP_523379.2 Ribosomal_L22 95..197 CDD:278658 32/101 (32%)
mrpl-22NP_499340.1 Ribosomal_L22 118..223 CDD:238205 34/104 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159688
Domainoid 1 1.000 77 1.000 Domainoid score I5767
eggNOG 1 0.900 - - E1_COG0091
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H56664
Inparanoid 1 1.050 113 1.000 Inparanoid score I3424
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45261
OrthoDB 1 1.010 - - D1054896at2759
OrthoFinder 1 1.000 - - FOG0002565
OrthoInspector 1 1.000 - - oto20153
orthoMCL 1 0.900 - - OOG6_101227
Panther 1 1.100 - - LDO PTHR13501
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4450
SonicParanoid 1 1.000 - - X4362
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1514.840

Return to query results.
Submit another query.