DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment goe and Nepl6

DIOPT Version :10

Sequence 1:NP_573160.1 Gene:goe / 32660 FlyBaseID:FBgn0027528 Length:879 Species:Drosophila melanogaster
Sequence 2:NP_609023.3 Gene:Nepl6 / 33893 FlyBaseID:FBgn0259716 Length:655 Species:Drosophila melanogaster


Alignment Length:44 Identity:8/44 - (18%)
Similarity:17/44 - (38%) Gaps:17/44 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   254 YHTMKAISTTRDMYVSIFVIQLSYILCNKRNMSSFLKLFKSDVT 297
            |.||.:::..                 ::.|.:||.:..:.||:
  Fly     3 YETMDSLAAK-----------------SRLNRNSFTQEKREDVS 29

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
goeNP_573160.1 GluZincin 184..>692 CDD:472708 8/44 (18%)
Nepl6NP_609023.3 M13 47..653 CDD:341056
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.