DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ERAS and mrasb

DIOPT Version :9

Sequence 1:NP_853510.1 Gene:ERAS / 3266 HGNCID:5174 Length:233 Species:Homo sapiens
Sequence 2:XP_003201047.1 Gene:mrasb / 100317924 ZFINID:ZDB-GENE-050208-495 Length:209 Species:Danio rerio


Alignment Length:198 Identity:78/198 - (39%)
Similarity:102/198 - (51%) Gaps:5/198 - (2%)


- Green bases have known domain annotations that are detailed below.


Human    36 GRQLPEYKAVVVGASGVGKSALTIQLNHQCFVEDHDPTIQDSYWKELTLDSGDCILNVLDTAGQA 100
            |..||.||.||||..||||||||||...:.||.|:||||:|||.|...:|....||:|||||||.
Zfish     9 GDNLPVYKLVVVGDGGVGKSALTIQFFQKIFVPDYDPTIEDSYLKHTEIDGQWAILDVLDTAGQE 73

Human   101 IHRALRDQCLAVCDGVLGVFALDDPSS---LIQLQQIWATWGPHPAQPLVLVGNKCDLVTTAGDA 162
            ...|:|:|.:...||.|.||::.|.:|   :.:..|:........:.|:|||.||.|||......
Zfish    74 EFSAMREQYMRTGDGFLIVFSVTDKASFEHVDRFHQLILRVKDRESFPMVLVANKVDLVHLRKIT 138

Human   163 HAAAAALAHSWGAHFVETSAK-TRQGVEEAFSLLVHEI-QRVQEAMAKEPMARSCREKTRHQKAT 225
            ......:|......::||||| ....|::||..||..| |::.|...|:......|.........
Zfish   139 SEQGREMASKHSITYIETSAKDPPMNVDKAFHELVRVIRQQIPERGLKKKRKGKWRADRPSASQR 203

Human   226 CHC 228
            .||
Zfish   204 LHC 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ERASNP_853510.1 RalA_RalB 42..201 CDD:206710 69/163 (42%)
Effector region 70..78 5/7 (71%)
mrasbXP_003201047.1 P-loop_NTPase 13..177 CDD:304359 69/163 (42%)
small_GTPase 27..179 CDD:197466 60/151 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1259506at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.