Sequence 1: | NP_853510.1 | Gene: | ERAS / 3266 | HGNCID: | 5174 | Length: | 233 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_003201047.1 | Gene: | mrasb / 100317924 | ZFINID: | ZDB-GENE-050208-495 | Length: | 209 | Species: | Danio rerio |
Alignment Length: | 198 | Identity: | 78/198 - (39%) |
---|---|---|---|
Similarity: | 102/198 - (51%) | Gaps: | 5/198 - (2%) |
- Green bases have known domain annotations that are detailed below.
Human 36 GRQLPEYKAVVVGASGVGKSALTIQLNHQCFVEDHDPTIQDSYWKELTLDSGDCILNVLDTAGQA 100
Human 101 IHRALRDQCLAVCDGVLGVFALDDPSS---LIQLQQIWATWGPHPAQPLVLVGNKCDLVTTAGDA 162
Human 163 HAAAAALAHSWGAHFVETSAK-TRQGVEEAFSLLVHEI-QRVQEAMAKEPMARSCREKTRHQKAT 225
Human 226 CHC 228 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ERAS | NP_853510.1 | RalA_RalB | 42..201 | CDD:206710 | 69/163 (42%) |
Effector region | 70..78 | 5/7 (71%) | |||
mrasb | XP_003201047.1 | P-loop_NTPase | 13..177 | CDD:304359 | 69/163 (42%) |
small_GTPase | 27..179 | CDD:197466 | 60/151 (40%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
NCBI | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1259506at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.920 |