DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32568 and wdb

DIOPT Version :9

Sequence 1:NP_001285351.1 Gene:CG32568 / 32659 FlyBaseID:FBgn0052568 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_001368946.1 Gene:wdb / 43312 FlyBaseID:FBgn0027492 Length:709 Species:Drosophila melanogaster


Alignment Length:293 Identity:103/293 - (35%)
Similarity:166/293 - (56%) Gaps:7/293 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 IVDLFSSFVNTHHFRPNPDGQRIDKIIVIKLVERLETTDVNDRKFMQSILRRVYLKCTDLRLFIR 95
            :.::|..|:.:..|:.....:.||:..|::|:|..::.|..:|.|::::|.|:|.|...||.|||
  Fly   334 VYEVFLRFLESQDFQATIGKRVIDQKFVLQLLELFDSEDPRERDFLKTVLHRIYGKFLGLRAFIR 398

  Fly    96 NQLNDVFFRLIFEGTDFHCIPEILEIYYDIIKGFTQPYETEHEQLLFKILLPLHKPPSLTKYFHQ 160
            .|:|::|.|.|:|...|:.:.|:|||...||.||..|.:.||:|.|.|:||||||...|:.|..|
  Fly   399 KQINNIFLRFIYETEHFNGVGELLEILGSIINGFALPLKAEHKQFLVKVLLPLHKVKCLSLYHAQ 463

  Fly   161 LIKCIIAFLNQYPSFIEKYVKGLLRLWPKTSFTKVTLFLSEIARILVIKNEQEVKKVMLTIFNHI 225
            |..||:.||.:.|...|..|:|||:.||||...|..:||.||..||.:.:..:..|:...:|..|
  Fly   464 LAYCIVQFLEKDPFLTEPVVRGLLKFWPKTCSQKEVMFLGEIEEILDVIDPPQFVKIQEPLFRQI 528

  Fly   226 AKCLCDESNKIAEHTLLLWKNNAVLEVIHRNHALIMPIVYPHVLRVLIRHYMRKPMQTNASI--- 287
            |||:.....::||..|.||.|...:.:|..|:|:||||::|.:.|:...|:    .||..::   
  Fly   529 AKCVSSPHFQVAERALYLWNNEYAMSLIEENNAVIMPIMFPALYRISKEHW----NQTIVALVYN 589

  Fly   288 ALCTLLKMNNPMLRCLTTVCMSTDHRPMKHDAE 320
            .|.|.::||:.:...||:...:...:..|.:.:
  Fly   590 VLKTFMEMNSKLFDELTSSYKAERQKEKKRERD 622

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32568NP_001285351.1 B56 <33..297 CDD:279883 99/266 (37%)
wdbNP_001368946.1 B56 235..633 CDD:396263 103/293 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466341
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2085
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S316
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D890437at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10257
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.800

Return to query results.
Submit another query.