DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34325 and Pax

DIOPT Version :9

Sequence 1:NP_001097003.1 Gene:CG34325 / 32656 FlyBaseID:FBgn0085354 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001033913.1 Gene:Pax / 35215 FlyBaseID:FBgn0041789 Length:581 Species:Drosophila melanogaster


Alignment Length:187 Identity:73/187 - (39%)
Similarity:97/187 - (51%) Gaps:13/187 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QPSICHKCNEVIQLRIITALGKTWHPEHFVCKDCQCPITEASFNINDGQPVCSACFVSNYSGICH 68
            |...|:.|.:.|..::|||||||||||||.|..|...:...:|...||.|.|...:.:.:|..|.
  Fly   344 QKGCCNACEKPIVGQVITALGKTWHPEHFTCNHCSQELGTRNFFERDGFPYCEPDYHNLFSPRCA 408

  Fly    69 GCKRPILERTIKAMGETWHEECFLCRGPCMQQLAGSSFYEHDGLPYCRTDFEHMFAARCGNCKAP 133
            .|...||::.:.|:.:|||.|.|.| ..|.||.....|:|.||.||||.|:..|||.:|..|...
  Fly   409 YCNGAILDKCVTALDKTWHTEHFFC-AQCGQQFGEEGFHERDGKPYCRNDYFEMFAPKCNGCNRA 472

  Fly   134 ITENAIVALDAKWHRECFKCKKCKTPITASSFVVEDNQP------------LCKACS 178
            |.||.|.||:::||.:||.|:.|:.|....||...:..|            ||..||
  Fly   473 IMENYISALNSQWHPDCFVCRDCRQPFQGGSFFDHEGLPYCETHYHAKRGSLCAGCS 529

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34325NP_001097003.1 LIM 8..59 CDD:295319 23/50 (46%)
LIM 67..119 CDD:295319 22/51 (43%)
LIM 127..175 CDD:295319 19/59 (32%)
PaxNP_001033913.1 LIM1_Paxillin_like 348..400 CDD:259830 23/51 (45%)
LIM2_Paxillin_like 407..458 CDD:188723 22/51 (43%)
LIM3_Paxillin_like 466..518 CDD:188724 18/51 (35%)
LIM4_Paxillin 525..576 CDD:188795 3/5 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453096
Domainoid 1 1.000 47 0.796 Domainoid score I4515
eggNOG 1 0.900 - - E1_KOG1703
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593918at2759
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 1 1.000 - - otm47179
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
87.750

Return to query results.
Submit another query.