DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4678 and Cpxm2

DIOPT Version :9

Sequence 1:NP_001138211.1 Gene:CG4678 / 32652 FlyBaseID:FBgn0030778 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_061355.3 Gene:Cpxm2 / 55987 MGIID:1926006 Length:764 Species:Mus musculus


Alignment Length:419 Identity:151/419 - (36%)
Similarity:224/419 - (53%) Gaps:56/419 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 LPEPRAY------MPDAQHLDFVYHDHEELTRFLRATSARYPNLTALYSIGKSIQGRDLWVMVVS 113
            ||:|..|      |.....|||.:|:::|:.:.::..:...||:|.:|:||||.||..|:.:.:|
Mouse   303 LPDPNNYYHRRNEMTTTDDLDFKHHNYKEMRQLMKVVNEMCPNITRIYNIGKSHQGLKLYAVEIS 367

  Fly   114 SSPYEHMVGKPDVKYVGNIHGNEPVGREMLLHLIQYFVTSYNT-DQYVKWLLDNTRIHILPTMNP 177
            ..|.||.||:|:..|:...||||.:|||:||.|:.:....|:. :..:..|::.|||||||::||
Mouse   368 DHPGEHEVGEPEFHYIAGAHGNEVLGRELLLLLLHFLCQEYSAQNARIVRLVEETRIHILPSLNP 432

  Fly   178 DGYAVSKEGTCD-GG--QGRYNARGFDLNRNFPD---------------------------YFKQ 212
            |||..:.||..: ||  .||:...|.|:|.||||                           :|..
Mouse   433 DGYEKAYEGGSELGGWSLGRWTHDGIDINNNFPDLNSLLWEAEDQQNAPRKVPNHYIAIPEWFLS 497

  Fly   213 NNKRGQPETDSVKDWISKIQFVLSGSLHGGALVASYPYDNTPNSRLLKGICRSSALCAMFQTYSA 277
            .|.....||.:|..|:.||.|||.|:|.||.||.:||||          :.||     :::|...
Mouse   498 ENATVATETRAVIAWMEKIPFVLGGNLQGGELVVAYPYD----------MVRS-----LWKTQEH 547

  Fly   278 APSLTPDDDVFKHLSLVYARNHAKM--SRGVACKSATPAFENGITNGAAWYPLTGGMQDYNYVWY 340
            .|  ||||.||:.|:..||..|..|  :|...|.:.....|.|..|||:|:.:.|.:.|::|:..
Mouse   548 TP--TPDDHVFRWLAYSYASTHRLMTDARRRVCHTEDFQKEEGTVNGASWHTVAGSLNDFSYLHT 610

  Fly   341 GCMEITLEISCCKFPPAYELKKYWEDNQLSLIKFLAEAHRGVQGFVFDPAGMPIERASIKIKGRD 405
            .|.|:::.:.|.|:|...||.:.||:|:.|||.|:.:.|||::|.|.|..|..|..|.|.::|.:
Mouse   611 NCFELSIYVGCDKYPHESELPEEWENNRESLIVFMEQVHRGIKGIVRDLQGKGISNAVISVEGVN 675

  Fly   406 VGFQTTKYGEFWRILLPGYYKVEVFAEGF 434
            ...:|...|::||:|.||.|.|...||||
Mouse   676 HDIRTASDGDYWRLLNPGEYVVTAKAEGF 704

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4678NP_001138211.1 M14_CP_N-E_like 72..377 CDD:199842 119/337 (35%)
Peptidase_M14NE-CP-C_like 381..455 CDD:200604 22/54 (41%)
Cpxm2NP_061355.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 71..136
FA58C 145..300 CDD:238014
FA58C 146..301 CDD:214572
M14_CPX_like 322..647 CDD:199851 122/341 (36%)
Peptidase_M14NE-CP-C_like 651..726 CDD:200604 22/54 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2649
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101221at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.