DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4678 and Cpe

DIOPT Version :9

Sequence 1:NP_001138211.1 Gene:CG4678 / 32652 FlyBaseID:FBgn0030778 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_037260.2 Gene:Cpe / 25669 RGDID:2394 Length:476 Species:Rattus norvegicus


Alignment Length:418 Identity:168/418 - (40%)
Similarity:232/418 - (55%) Gaps:53/418 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 EPGLP----EPRAYMPDAQHLDFVYHDHEELTRFLRATSARYPNLTALYSIGKSIQGRDLWVMVV 112
            |||.|    ..|..:.....:.|.||.:.||...|.:...:...::.:|::|:|.:||:|.|:.:
  Rat    29 EPGAPAAGMRRRRRLQQEDGISFEYHRYPELREALVSVWLQCTAISRIYTVGRSFEGRELLVIEL 93

  Fly   113 SSSPYEHMVGKPDVKYVGNIHGNEPVGREMLLHLIQYFVTSYNT-DQYVKWLLDNTRIHILPTMN 176
            |.:|..|..|:|:.||:||:||||.||||:|:.|.||....|.. ::.:..|:.:|||||:|::|
  Rat    94 SDNPGVHEPGEPEFKYIGNMHGNEAVGRELLIFLAQYLCNEYQRGNETIVNLIHSTRIHIMPSLN 158

  Fly   177 PDGY--AVSKEGTC-DGGQGRYNARGFDLNRNFPDYFK---QNNKRG------------------ 217
            |||:  |.|:.|.. |...||.||:|.||||||||..:   .|.|.|                  
  Rat   159 PDGFEKAASQPGELKDWFVGRSNAQGIDLNRNFPDLDRIVYVNEKEGGPNNHLLKNLKKIVDQNS 223

  Fly   218 --QPETDSVKDWISKIQFVLSGSLHGGALVASYPYDNTPNSRLLKGICRSSALCAMFQTYSAAPS 280
              .|||.:|..||..|.||||.:||||.|||:||||.|.:     |.....:.|           
  Rat   224 KLAPETKAVIHWIMDIPFVLSANLHGGDLVANYPYDETRS-----GTAHEYSSC----------- 272

  Fly   281 LTPDDDVFKHLSLVYARNHAKMS--RGVACK--SATPAFENGITNGAAWYPLTGGMQDYNYVWYG 341
              |||.:|:.|:..|:..:..||  ....|:  ....:|.:|.|||.|||.:.|||||:||:...
  Rat   273 --PDDAIFQSLARAYSSFNPVMSDPNRPPCRKNDDDSSFVDGTTNGGAWYSVPGGMQDFNYLSSN 335

  Fly   342 CMEITLEISCCKFPPAYELKKYWEDNQLSLIKFLAEAHRGVQGFVFDPAGMPIERASIKIKGRDV 406
            |.|||:|:||.||||...||.|||||:.|||.:|.:.||||:|||.|..|.||..|:|.:.|.|.
  Rat   336 CFEITVELSCEKFPPEETLKSYWEDNKNSLINYLEQIHRGVKGFVRDLQGNPIANATISVDGIDH 400

  Fly   407 GFQTTKYGEFWRILLPGYYKVEVFAEGF 434
            ...:.|.|::||:|.||.||:...|.|:
  Rat   401 DVTSAKDGDYWRLLAPGNYKLTASAPGY 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4678NP_001138211.1 M14_CP_N-E_like 72..377 CDD:199842 136/335 (41%)
Peptidase_M14NE-CP-C_like 381..455 CDD:200604 24/54 (44%)
CpeNP_037260.2 M14_CPE 53..371 CDD:349437 136/335 (41%)
Peptidase_M14NE-CP-C_like 375..449 CDD:200604 24/54 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101221at2759
OrthoFinder 1 1.000 - - FOG0000769
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.