DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4678 and AEBP1

DIOPT Version :9

Sequence 1:NP_001138211.1 Gene:CG4678 / 32652 FlyBaseID:FBgn0030778 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_001120.3 Gene:AEBP1 / 165 HGNCID:303 Length:1158 Species:Homo sapiens


Alignment Length:519 Identity:165/519 - (31%)
Similarity:255/519 - (49%) Gaps:78/519 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LLLMLHLLLCDAKTVNPGDSMQMQHHQMTAEPGLPEPRAYMPDAQHLDFVYHDHEELTRFLRATS 86
            |.:.|.:|.|   :|.|..|...|:..:..:              .|||.:|.::::.:.::..:
Human   531 LCMRLEVLGC---SVAPVYSYYAQNEVVATD--------------DLDFRHHSYKDMRQLMKVVN 578

  Fly    87 ARYPNLTALYSIGKSIQGRDLWVMVVSSSPYEHMVGKPDVKYVGNIHGNEPVGREMLLHLIQYFV 151
            ...|.:|..||:|||.:|..::.|.:|.:|.||.:|:|:.:|...|||||.:|||:||.|:||..
Human   579 EECPTITRTYSLGKSSRGLKIYAMEISDNPGEHELGEPEFRYTAGIHGNEVLGRELLLLLMQYLC 643

  Fly   152 TSY-NTDQYVKWLLDNTRIHILPTMNPDGYAVSKEGTCDGGQ---GRYNARGFDLNRNFPD---- 208
            ..| :.:..|:.|:.:||||::|::|||||.|:.:...:.|.   |.:...|||:..:|||    
Human   644 REYRDGNPRVRSLVQDTRIHLVPSLNPDGYEVAAQMGSEFGNWALGLWTEEGFDIFEDFPDLNSV 708

  Fly   209 -----------YFKQNNKRGQP------------ETDSVKDWISKIQFVLSGSLHGGALVASYPY 250
                       |...||....|            |..::..|:.|..|||..:|:||..:.||||
Human   709 LWGAEERKWVPYRVPNNNLPIPERYLSPDATVSTEVRAIIAWMEKNPFVLGANLNGGERLVSYPY 773

  Fly   251 D--NTPNSRLLKGICRSSALCAMFQTYSAAPSLTPDDDVFKHLSLVYARNHAKMS---RGVACKS 310
            |  .||....|.....::|........|.|.. |||..:|:.|::.:|..|..::   || .|::
Human   774 DMARTPTQEQLLAAAMAAARGEDEDEVSEAQE-TPDHAIFRWLAISFASAHLTLTEPYRG-GCQA 836

  Fly   311 ATPAFENGITNGAAWYPLTGGMQDYNYVWYGCMEITLEISCCKFPPAYELKKYWEDNQLSLIKFL 375
            .......||.|||.|.|.||.:.|::|:...|:|::..:.|.|||...||.:.||:|:.:|:.|:
Human   837 QDYTGGMGIVNGAKWNPRTGTINDFSYLHTNCLELSFYLGCDKFPHESELPREWENNKEALLTFM 901

  Fly   376 AEAHRGVQGFVFDPAGMPIERASIKIKGRDVGFQTTKYGEFWRILLPGYYKVEVFAEGFAPR--- 437
            .:.|||::|.|.|..|:||..|:|.:.|.:.|.:|...|::||||.||.|:|...|||:.|.   
Human   902 EQVHRGIKGVVTDEQGIPIANATISVSGINHGVKTASGGDYWRILNPGEYRVTAHAEGYTPSAKT 966

  Fly   438 -EVEFVIVEQHPTLLNVTLQPS--KRLEGIGPMGPGGVPVGGVVGPGGLYRPIPSPQHYRPPVP 498
             .|::.|   ..|..|..|..|  ||:..|..|...              ||||.....||..|
Human   967 CNVDYDI---GATQCNFILARSNWKRIREIMAMNGN--------------RPIPHIDPSRPMTP 1013

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4678NP_001138211.1 M14_CP_N-E_like 72..377 CDD:199842 110/340 (32%)
Peptidase_M14NE-CP-C_like 381..455 CDD:200604 29/77 (38%)
AEBP1NP_001120.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 40..387
FA58C 384..540 CDD:214572 3/8 (38%)
FA58C 386..539 CDD:238014 2/7 (29%)
Required for DNA-binding and interaction with NFKBIA. /evidence=ECO:0000250 390..555 8/26 (31%)
Interaction with MAPK1 and MAPK3. /evidence=ECO:0000250 421..624 28/109 (26%)
Interaction with PTEN. /evidence=ECO:0000250 555..985 145/448 (32%)
M14_CPX_like 560..903 CDD:199851 113/344 (33%)
Peptidase_M14NE-CP-C_like 907..982 CDD:200604 29/77 (38%)
Required for transcriptional repression. /evidence=ECO:0000250 941..1158 29/90 (32%)
Interaction with MAPK1 and MAPK3. /evidence=ECO:0000250 1006..1158 3/8 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1108..1141
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2649
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101221at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.