DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4678 and CPXM2

DIOPT Version :9

Sequence 1:NP_001138211.1 Gene:CG4678 / 32652 FlyBaseID:FBgn0030778 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_937791.2 Gene:CPXM2 / 119587 HGNCID:26977 Length:756 Species:Homo sapiens


Alignment Length:419 Identity:150/419 - (35%)
Similarity:223/419 - (53%) Gaps:56/419 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 LPEPRAY------MPDAQHLDFVYHDHEELTRFLRATSARYPNLTALYSIGKSIQGRDLWVMVVS 113
            ||:|..|      |.....|||.:|:::|:.:.::..:...||:|.:|:||||.||..|:.:.:|
Human   295 LPDPNNYYHRRNEMTTTDDLDFKHHNYKEMRQLMKVVNEMCPNITRIYNIGKSHQGLKLYAVEIS 359

  Fly   114 SSPYEHMVGKPDVKYVGNIHGNEPVGREMLLHLIQYFVTSY-NTDQYVKWLLDNTRIHILPTMNP 177
            ..|.||.||:|:..|:...||||.:|||:||.|:|:....| ..:..:..|::.||||:||::||
Human   360 DHPGEHEVGEPEFHYIAGAHGNEVLGRELLLLLVQFVCQEYLARNARIVHLVEETRIHVLPSLNP 424

  Fly   178 DGYAVSKEGTCD-GG--QGRYNARGFDLNRNFPD---------------------------YFKQ 212
            |||..:.||..: ||  .||:...|.|:|.||||                           :|..
Human   425 DGYEKAYEGGSELGGWSLGRWTHDGIDINNNFPDLNTLLWEAEDRQNVPRKVPNHYIAIPEWFLS 489

  Fly   213 NNKRGQPETDSVKDWISKIQFVLSGSLHGGALVASYPYDNTPNSRLLKGICRSSALCAMFQTYSA 277
            .|.....||.:|..|:.||.|||.|:|.||.||.:||||          :.||.     ::|...
Human   490 ENATVAAETRAVIAWMEKIPFVLGGNLQGGELVVAYPYD----------LVRSP-----WKTQEH 539

  Fly   278 APSLTPDDDVFKHLSLVYARNHAKM--SRGVACKSATPAFENGITNGAAWYPLTGGMQDYNYVWY 340
            .|  ||||.||:.|:..||..|..|  :|...|.:.....|.|..|||:|:.:.|.:.|::|:..
Human   540 TP--TPDDHVFRWLAYSYASTHRLMTDARRRVCHTEDFQKEEGTVNGASWHTVAGSLNDFSYLHT 602

  Fly   341 GCMEITLEISCCKFPPAYELKKYWEDNQLSLIKFLAEAHRGVQGFVFDPAGMPIERASIKIKGRD 405
            .|.|:::.:.|.|:|...:|.:.||:|:.|||.|:.:.|||::|.|.|..|..|..|.|.::|.:
Human   603 NCFELSIYVGCDKYPHESQLPEEWENNRESLIVFMEQVHRGIKGLVRDSHGKGIPNAIISVEGIN 667

  Fly   406 VGFQTTKYGEFWRILLPGYYKVEVFAEGF 434
            ...:|...|::||:|.||.|.|...||||
Human   668 HDIRTANDGDYWRLLNPGEYVVTAKAEGF 696

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4678NP_001138211.1 M14_CP_N-E_like 72..377 CDD:199842 118/337 (35%)
Peptidase_M14NE-CP-C_like 381..455 CDD:200604 22/54 (41%)
CPXM2NP_937791.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 51..131
FA58C 137..292 CDD:238014
FA58C 138..293 CDD:214572
M14_CPX_like 314..639 CDD:199851 121/341 (35%)
Peptidase_M14NE-CP-C_like 643..718 CDD:200604 22/54 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2649
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101221at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.