DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4678 and cpd

DIOPT Version :9

Sequence 1:NP_001138211.1 Gene:CG4678 / 32652 FlyBaseID:FBgn0030778 Length:527 Species:Drosophila melanogaster
Sequence 2:XP_031752525.1 Gene:cpd / 100135269 XenbaseID:XB-GENE-1013552 Length:1339 Species:Xenopus tropicalis


Alignment Length:413 Identity:179/413 - (43%)
Similarity:250/413 - (60%) Gaps:34/413 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 QMTAEPGLPEPRAYMPDAQHLDFVYHDHEELTRFLRATSARYPNLTALYSIGKSIQGRDLWVMVV 112
            |.|..|.:    |..|.    ||.:|.:.::..||....:.||::|..||:|||::.:||:||.:
 Frog   444 QSTTTPRI----AIQPQ----DFRHHRYTDMEIFLMKFHSEYPSITRRYSVGKSVEQKDLYVMEI 500

  Fly   113 SSSPYEHMVGKPDVKYVGNIHGNEPVGREMLLHLIQYFVTSYNTDQYVKWLLDNTRIHILPTMNP 177
            |.:|..|..|:|:.||:||:||||.||||:||:||:|...:|..|..|.:|:.||||||:|:|||
 Frog   501 SDNPGIHEPGEPEFKYIGNMHGNEVVGRELLLNLIEYLCKNYGIDPEVTYLVQNTRIHIMPSMNP 565

  Fly   178 DGYAVSKEGTCDGGQGRYNARGFDLNRNFPDYFKQNNKRGQPETDSVKDWISKIQFVLSGSLHGG 242
            |||..::||..||..||.|:..|||||||||.|.|.....||||.:|..|:....||||.:||||
 Frog   566 DGYEKAEEGDKDGLVGRNNSNHFDLNRNFPDQFFQITDPPQPETLAVMTWLKTYPFVLSANLHGG 630

  Fly   243 ALVASYPYDNTPNSRLLKGICRSSALCAMFQTYSAAPSLTPDDDVFKHLSLVYARNHAKMSRGVA 307
            :||.:||:|:..     ||:          .|||.    :|||.||:||:|.|::.:.||..|..
 Frog   631 SLVVNYPFDDDE-----KGL----------STYSK----SPDDPVFQHLALSYSKENNKMYEGFP 676

  Fly   308 CKSATP--AFENGITNGAAWYPLTGGMQDYNYVWYGCMEITLEISCCKFPPAYELKKYWEDNQLS 370
            ||...|  .|..||||||.||.:.|||||:||:...|.|:|:|:.|.|:|.|.:|..|||.|:.|
 Frog   677 CKEMYPNENFPQGITNGANWYNVPGGMQDWNYLNTNCFEVTIELGCVKYPMAEKLPAYWESNRRS 741

  Fly   371 LIKFLAEAHRGVQGFVFDPA-GMPIERASIKIKGRDVGFQTTKY--GEFWRILLPGYYKVEVFAE 432
            :::|:.:.|.|::||:.|.. |..|..|:|.:.|  :....|.|  |:|||:|:||.|||...|:
 Frog   742 MLQFIKQVHIGIKGFILDATDGRGILNATISVAG--INHMVTSYKDGDFWRLLVPGAYKVTASAK 804

  Fly   433 GFAPREVEFVIVEQHPTLLNVTL 455
            |:.|......:.|....|:|.||
 Frog   805 GYGPVTKNVNVTEGEAVLVNFTL 827

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4678NP_001138211.1 M14_CP_N-E_like 72..377 CDD:199842 142/306 (46%)
Peptidase_M14NE-CP-C_like 381..455 CDD:200604 27/76 (36%)
cpdXP_031752525.1 M14_CPD_I 39..333 CDD:349440
Peptidase_M14NE-CP-C_like 337..413 CDD:200604
M14_CPD_II 453..748 CDD:349435 145/317 (46%)
Peptidase_M14NE-CP-C_like 752..827 CDD:200604 27/76 (36%)
M14_CPD_III 886..1169 CDD:349464
Peptidase_M14NE-CP-C_like 1173..1248 CDD:200604
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 51 1.000 Domainoid score I11366
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101221at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.