DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9672 and PROZ

DIOPT Version :9

Sequence 1:NP_573151.1 Gene:CG9672 / 32651 FlyBaseID:FBgn0030777 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_016876301.1 Gene:PROZ / 8858 HGNCID:9460 Length:467 Species:Homo sapiens


Alignment Length:188 Identity:38/188 - (20%)
Similarity:67/188 - (35%) Gaps:55/188 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 AAGVLEAQPQGRIAGGEDAVLGQLPYQAALSIG-GSYNCGAVIIGQRYALTALSCVCSDGKDTPW 76
            |.|||.::.:.       ..|..||:|..|:.. |...||.|||.:.:.||...|.......|  
Human   239 ACGVLTSEKRA-------PDLQDLPWQVKLTNSEGKDFCGGVIIRENFVLTTAKCSLLHRNIT-- 294

  Fly    77 AAVLFAVTVGSVDLYNGK------QIRVEEITINPNY--STLKTGIALLRLQ------------- 120
                       |..|..:      .|::..:.::..|  ...:..::||.|:             
Human   295 -----------VKTYFNRTSQDPLMIKITHVHVHMRYDADAGENDLSLLELEWPIQCPGAGLPVC 348

  Fly   121 -EEITFSETVNAIPLSQDVPPMGSQVEVSGWGRTTESEVNMHRTLQIGAAEVMAPREC 177
             .|..|:|.: .||.::.:        :|||.|   :..::..:|......::...||
Human   349 TPEKDFAEHL-LIPRTRGL--------LSGWAR---NGTDLGNSLTTRPVTLVEGEEC 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9672NP_573151.1 Tryp_SPc 24..247 CDD:214473 34/177 (19%)
Tryp_SPc 25..250 CDD:238113 34/176 (19%)
PROZXP_016876301.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24278
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.