DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9672 and proza

DIOPT Version :9

Sequence 1:NP_573151.1 Gene:CG9672 / 32651 FlyBaseID:FBgn0030777 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001314721.1 Gene:proza / 768176 ZFINID:ZDB-GENE-061013-403 Length:426 Species:Danio rerio


Alignment Length:230 Identity:54/230 - (23%)
Similarity:93/230 - (40%) Gaps:56/230 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LEAQPQGRIAGGEDAVLGQLPYQAALSIGGSYNCGAVIIGQRYALTALSCVCSDGKDTPWAAVLF 81
            ::::.:|...|.|:.     |:||.|..|.|..|..||:.:...||...|......        |
Zfish   193 IKSEYEGFPCGPEEC-----PWQAMLLRGSSGFCSGVILKENLVLTTAQCARKHPD--------F 244

  Fly    82 AVTVGS-VDLY--NGKQIRVEEITINPNYS--TLKTGIALLRLQEEITFSETVNAIPL-----SQ 136
            .|.||. :.::  :|:.:.|.::.::|.:|  |.:..:|||.|::.|.|.::|.|..|     :.
Zfish   245 QVAVGKRMTMFESSGQTLAVRQVHLHPLHSTGTAENDLALLELRDRIIFKKSVAAACLPERDFAD 309

  Fly   137 DVPPMGSQV-EVSGWGRT-TESEVNMHRTL-----------------QIGAAEVMA--PR---EC 177
            .|...|..: .|:||..| ||..:..|..|                 |:.:.::|.  ||   :|
Zfish   310 RVLTAGQYMGVVTGWKDTPTEDGIEGHLLLNHLSYQTLQDCSRQHSAQVSSNKLMCSLPRAKADC 374

  Fly   178 ALANRDELLVADDQVLCLGHGRRQGICSGDIGGPA 212
            .......:|....:|..|         :|.:..||
Zfish   375 VFGQGSPVLTLHREVFFL---------TGMVSRPA 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9672NP_573151.1 Tryp_SPc 24..247 CDD:214473 53/223 (24%)
Tryp_SPc 25..250 CDD:238113 53/222 (24%)
prozaNP_001314721.1 GLA 28..90 CDD:214503
EGF_CA 91..127 CDD:238011
FXa_inhibition 140..164 CDD:291342
Tryp_SPc 199..423 CDD:304450 54/224 (24%)
Trypsin 199..420 CDD:278516 54/224 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24278
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.