Sequence 1: | NP_573151.1 | Gene: | CG9672 / 32651 | FlyBaseID: | FBgn0030777 | Length: | 253 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001035400.1 | Gene: | f9b / 678552 | ZFINID: | ZDB-GENE-060421-7346 | Length: | 507 | Species: | Danio rerio |
Alignment Length: | 208 | Identity: | 51/208 - (24%) |
---|---|---|---|
Similarity: | 98/208 - (47%) | Gaps: | 35/208 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 24 RIAGGEDAVLGQLPYQAAL--SIGGSYNCGAVIIGQRYALTALSCVCSDGKDTPWAAVLFAVTVG 86
Fly 87 SVDLYNGKQIR----VEEITINPNYSTLKT----GIALLRLQEEITFSETVNAIPL-------SQ 136
Fly 137 DVPPMGSQVEVSGWGRTTES--EVNMHRTLQIGAAEVMAPRECALANRDELLVADDQVLCLGHGR 199
Fly 200 -RQGICSGDIGGP 211 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG9672 | NP_573151.1 | Tryp_SPc | 24..247 | CDD:214473 | 51/208 (25%) |
Tryp_SPc | 25..250 | CDD:238113 | 50/207 (24%) | ||
f9b | NP_001035400.1 | GLA | 23..86 | CDD:214503 | |
EGF_CA | 88..124 | CDD:238011 | |||
FXa_inhibition | 131..167 | CDD:291342 | |||
Tryp_SPc | 255..487 | CDD:214473 | 51/208 (25%) | ||
Tryp_SPc | 256..490 | CDD:238113 | 50/207 (24%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24278 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |