DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9672 and f9b

DIOPT Version :9

Sequence 1:NP_573151.1 Gene:CG9672 / 32651 FlyBaseID:FBgn0030777 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001035400.1 Gene:f9b / 678552 ZFINID:ZDB-GENE-060421-7346 Length:507 Species:Danio rerio


Alignment Length:208 Identity:51/208 - (24%)
Similarity:98/208 - (47%) Gaps:35/208 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RIAGGEDAVLGQLPYQAAL--SIGGSYNCGAVIIGQRYALTALSCVCSDGKDTPWAAVLFAVTVG 86
            ||.||::|:.|::|:|...  .:.....||..::.:.:.:||..||  :||...     |.:.||
Zfish   255 RIVGGDEAIPGEIPWQVVFLEKVNKIVFCGGSLLSEEWVITAAHCV--EGKQGS-----FFIRVG 312

  Fly    87 SVDLYNGKQIR----VEEITINPNYSTLKT----GIALLRLQEEITFSETVNAIPL-------SQ 136
            ..|:...:...    :||..|:|.|::.::    .||||:|::.:...:  .|:|:       ::
Zfish   313 EHDVSKMEGTESDHGIEEYHIHPRYNSQRSLYNHDIALLKLKKPVILFD--YAVPICLGSKDFTE 375

  Fly   137 DVPPMGSQVEVSGWGRTTES--EVNMHRTLQIGAAEVMAPRECALANRDELLVADDQVLCLGHGR 199
            ::........||||||....  |.|:.:.:::...:.:   :|..::.|.:   ...:.|.|:..
Zfish   376 NLLQSAENSLVSGWGRLRYGGIESNVLQKVELPYVDRI---KCKGSSTDSI---SRFMFCAGYST 434

  Fly   200 -RQGICSGDIGGP 211
             |:..|.||.|||
Zfish   435 VRKDACQGDSGGP 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9672NP_573151.1 Tryp_SPc 24..247 CDD:214473 51/208 (25%)
Tryp_SPc 25..250 CDD:238113 50/207 (24%)
f9bNP_001035400.1 GLA 23..86 CDD:214503
EGF_CA 88..124 CDD:238011
FXa_inhibition 131..167 CDD:291342
Tryp_SPc 255..487 CDD:214473 51/208 (25%)
Tryp_SPc 256..490 CDD:238113 50/207 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24278
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.