DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9672 and 2210010C04Rik

DIOPT Version :9

Sequence 1:NP_573151.1 Gene:CG9672 / 32651 FlyBaseID:FBgn0030777 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_075822.3 Gene:2210010C04Rik / 67373 MGIID:1914623 Length:247 Species:Mus musculus


Alignment Length:259 Identity:72/259 - (27%)
Similarity:114/259 - (44%) Gaps:23/259 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLTLTIGLILVAAGVLEAQPQGRIAGGEDAVLGQLPYQAALSIGGSYNCGAVIIGQRYALTALS 65
            ||..:.:..:..|..:.......:|.||.......||||.:|: .|.:.||..:|..::.::|..
Mouse     1 MKTLIFLAFLGAAVALPLDDDDDKIVGGYTCQRNALPYQVSLN-SGYHFCGGSLINSQWVVSAAH 64

  Fly    66 CVCSDGKDTPWAAVLFAVTVG--SVD-LYNGKQ-IRVEEITINPNY--STLKTGIALLRLQEEIT 124
            |..|          ...|.:|  ::| |..|:| |...:|..:|||  :|....|.|::|:...|
Mouse    65 CYKS----------RIQVRLGEHNIDALEGGEQFIDAAKIIRHPNYNANTYNNDIMLIKLKTAAT 119

  Fly   125 FSETVNAIPLSQDVPPMGSQVEVSGWGRTTESEVNMHRTLQIGAAEVMAPRECALANRDELLVAD 189
            .:..|:.:.|.:..|..|::..|||||.|..|..|....||...|.|::...|..:...::   .
Mouse   120 LNSRVSTVALPRSCPSAGTRCLVSGWGNTLSSGTNYPSLLQCLDAPVLSDSSCTSSYPGKI---T 181

  Fly   190 DQVLCLG--HGRRQGICSGDIGGPAVYQGQLVGLGAQILGECGGMLPERFISIAANYDWIQQQL 251
            ..:.|||  .|.:.. |.||.|||.|..|||.|:.:...|......|..:..:....:||||.:
Mouse   182 SNMFCLGFLEGGKDS-CQGDSGGPVVCNGQLQGVVSWGYGCAQRGKPGVYTKVCKYVNWIQQTI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9672NP_573151.1 Tryp_SPc 24..247 CDD:214473 65/230 (28%)
Tryp_SPc 25..250 CDD:238113 68/232 (29%)
2210010C04RikNP_075822.3 Tryp_SPc 24..240 CDD:214473 65/230 (28%)
Tryp_SPc 25..243 CDD:238113 68/232 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.