DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9672 and Proz

DIOPT Version :9

Sequence 1:NP_573151.1 Gene:CG9672 / 32651 FlyBaseID:FBgn0030777 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_080110.1 Gene:Proz / 66901 MGIID:1860488 Length:399 Species:Mus musculus


Alignment Length:181 Identity:37/181 - (20%)
Similarity:69/181 - (38%) Gaps:68/181 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 PYQAALSIG-GSYNCGAVIIGQRYALTALSCVCSDGKDTPWAAVLFA-VTV-GSVDLYNGKQIRV 98
            |:|..|:.. |...|..|::.:.:.||...|           ::|.: ::| .:||    ::||:
Mouse   194 PWQVRLTNSEGEDFCAGVLLQEDFVLTTAKC-----------SLLHSNISVKANVD----QRIRI 243

  Fly    99 EEITINPNY--STLKTGIALLRLQE--------------EITFSETVNAIPLSQDVPPMGSQVEV 147
            :...::..|  .:.:..::||:|:|              |..|:|.| .||        |::..:
Mouse   244 KSTHVHMRYDEESGENDVSLLQLEEPLQCPSSGLPVCVPERDFAEHV-LIP--------GTEGLL 299

  Fly   148 SGW------------------------GRTTESEVNMHRTLQIGAAEVMAP 174
            |||                        |:|....|....:.:.|:. ||.|
Mouse   300 SGWMLNGTHLATTPMLLSVTQADGEECGQTLNVTVTTRTSCEKGSV-VMGP 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9672NP_573151.1 Tryp_SPc 24..247 CDD:214473 37/181 (20%)
Tryp_SPc 25..250 CDD:238113 37/181 (20%)
ProzNP_080110.1 GLA 23..85 CDD:214503
EGF_CA <95..122 CDD:238011
FXa_inhibition 136..165 CDD:291342
Tryp_SPc 192..397 CDD:304450 37/181 (20%)
Trypsin 192..>340 CDD:278516 33/169 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24278
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.