DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9672 and CG17242

DIOPT Version :9

Sequence 1:NP_573151.1 Gene:CG9672 / 32651 FlyBaseID:FBgn0030777 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001259921.1 Gene:CG17242 / 59226 FlyBaseID:FBgn0250841 Length:245 Species:Drosophila melanogaster


Alignment Length:223 Identity:57/223 - (25%)
Similarity:102/223 - (45%) Gaps:29/223 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LVAAGVLEAQPQGRIAGGEDAV-LGQLPYQAALSIGGSYNCGAVIIGQRYALTALSCVCSDGKDT 74
            ::..|:|......:||....:: :.|.|:||::.|...::||.||..:...||...||..     
  Fly     1 MLLKGILLLVSIAQIAADFKSIGIEQAPWQASVQINDKHHCGGVIYSEDIILTIAECVRK----- 60

  Fly    75 PWAAVLF-AVTVGSVDLYNG------KQIRVEEITINPNYSTLKTGIALLRLQEEITFSETVNAI 132
              |.:.| :|.|||.....|      :::|::.:.:.|      :.:|:|:|:..:.....:.||
  Fly    61 --ARLEFISVRVGSAQENAGGTVLKVEKMRLQVLGLRP------SDVAILQLRSPLYLDGGIRAI 117

  Fly   133 PLSQDVPPMGSQVEVSGWGRTT----ESEVNMHRTLQIGAAEVMAPRECALANRDELLVADDQVL 193
            ||:......|:...|||||:.:    .|||.:...::| ..::|.....||..|   |::..::.
  Fly   118 PLATIPLVPGTNASVSGWGQLSAMNPSSEVLLRVDVKI-QDQLMCATNLALKGR---LMSVGEIC 178

  Fly   194 CLGHGRRQGICSGDIGGPAVYQGQLVGL 221
            ....|.....|.|.:|||.|...:|.|:
  Fly   179 AAPAGEIPYACQGFVGGPLVANNRLYGI 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9672NP_573151.1 Tryp_SPc 24..247 CDD:214473 55/210 (26%)
Tryp_SPc 25..250 CDD:238113 55/209 (26%)
CG17242NP_001259921.1 Tryp_SPc 24..235 CDD:238113 53/200 (27%)
Tryp_SPc 24..232 CDD:214473 53/200 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.