DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9672 and CG17234

DIOPT Version :9

Sequence 1:NP_573151.1 Gene:CG9672 / 32651 FlyBaseID:FBgn0030777 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster


Alignment Length:258 Identity:77/258 - (29%)
Similarity:114/258 - (44%) Gaps:37/258 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LTIGLILVAAGVLEAQPQGRIAGGEDAVLGQLPYQAALSIGGSYNCGAVIIGQRYALTALSCVCS 69
            |.:.|..::||.:....| ||.|||...:.|:|:|.:|...|.:.||..|..:...:||..|...
  Fly     8 LLLALDFLSAGQVNRWEQ-RIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHCFFD 71

  Fly    70 D--------GKDTPWAAVLFAVTVGS-VDLYNGKQIRVEEITINPNYS-TLK-TGIALLRLQEEI 123
            :        |         :.|..|| :...||..:.|..:.|:..|: .|. ..||::||...:
  Fly    72 EEGNRLDDQG---------YQVRAGSALTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLSTPL 127

  Fly   124 TFSETVNAIPLSQDVPPMGSQVEVSGWGRT--TESEVNMHRT-LQIGAAEVMAPRECALANRDEL 185
            .|:..|..|||::..|...|...|||||.:  .....|::.| ||..|..:.:...|.|      
  Fly   128 EFTSKVQPIPLAKTNPYPRSIALVSGWGVSYILNDSTNLYPTHLQGLALHIKSIFSCRL------ 186

  Fly   186 LVADDQVLCLG-HGRRQGICSGDIGGPAVYQGQLVGLGAQILGECGGMLPERFISIAANYDWI 247
              .|..:||.| :||.  .|.||.|||.|...||||:.:  .|..|.:....|:|:....:||
  Fly   187 --FDPSLLCAGTYGRT--ACHGDSGGPLVVNKQLVGVVS--WGRKGCVSSAFFVSVPYFREWI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9672NP_573151.1 Tryp_SPc 24..247 CDD:214473 70/237 (30%)
Tryp_SPc 25..250 CDD:238113 71/238 (30%)
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 70/237 (30%)
Tryp_SPc 27..243 CDD:238113 69/236 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.